Cherry SNP DataBase

Gene information

Gene Pav_sc0000800.1_g1120.1.mk
Chromosome name PAV_r1.0chr1
start 33228319
end 33232137
PAV_r1.0 name Pav_sc0000800.1
start 663655
end 667473
direction +
Annotation NR PREDICTED: aspartate aminotransferase, cytoplasmic
Sequence CDS ATGCGCCCACAGTTCACATCACCCGACGCCCATAGTTCTTCTCCTGCCTTTTCTTCTTCT TCTTCTTCAAGCAGCAGTGATCGGAGGCTCAACGCTCTCGTGCGCCACCTTGATTCGTCT GCCATGGATCCTAACAACAACAGCTCAATCTCTGCTTCGCCAACTTCGGCACATGCCAAT TCTGTCTTCGCTCACGTCGTTCGCGCCCCTGAGGATCCAATCCTTGGGGTGACTGTTGCA TACAACAAAGATCCGAGCCCAGCTAAGTTGAATTTGGGTGTTGGTGCTTATCGAACTGAG GAAGGAAAACCACTTGTTCTGAATGTAGTGAGGAAAGCAGAACAGCTGCTTGTTAATGAC AGGTCTCGCGTTAAGGAATATCTTCCTATTGTTGGACTGGCAGATTTCAATAAACTGAGT GCTAAGCTGATTCTTGGTGCTGACAGCCCTCCTATTCAAGAGAACCGGATTACTACTGCC CAATGTCTGTCAGGAACTGGCTCATTGAGAGTTGGAGGTGAATTTTTGGCAAAGCATTAT CATGAACGCACAATATACATACCCCAGCCAACATGGGGAAACCACACAAAAGTTTTCACT CTGGCAGGGTTGTCTGTGAAAAGTTACCGATATTATGATCCAGCAACGCGTGGCCTCAAC TTCCAAGGCCTCTTAGAAGACCTTCGTTCTGCCCCAGCTGGAGCAATTGTACTTCTCCAT GCATGTGCTCATAACCCCACTGGTGTTGATCCAACCCTTGAGCAGTGGGAGCAGATCAGA CAGCTTGTGAGATCAAGAGGATTATTACCATTCTTTGACAGTGCTTATCAGGGTTTTGCT AGTGGAAGTTTGGATGCAGATGCAGAGTCTGTTCGTAGGTTTGCTGCTGATGGTGGAGAG TGCCTTATAGCTCAAAGTTATGCGAAAAACATGGGGCTCTATGGAGAACGTGTTGGTGCC CTAAGCATTGTCTGCAAGACTGCTGATGTTGCAAGTAAGGTTGAGAGCCAACTGAAGCTT GTGATCAGGCCCATGTATTCAAACCCACCCATTCACGGTGCATCTATTGTAGCCACCATT CTCAAGGATAGGGACTTGTTCAATGAATGGACAATTGAGTTGAAGGCAATGGCTGACCGT ATCATCAGCATGCGACATCAACTGTTTGAATCCTTGCGTGCCAAGGGCACACCTGGTGAC TGGAGCCACATCATCAAGCAGATTGGAATGTTTACCTTCACAGGATTGAACTCCGAGCAA GTTGCTTTCATGACTAAAGAGTACCATATCTACATGACATCTGATGGGAGGATTAGCATG GCTGGTCTGAGTTCAAGGACCGTCCCCCATCTTACAGAGGCAATACATGCAGCTGTTACT CGCGTTGCCTAA
PEP MRPQFTSPDAHSSSPAFSSSSSSSSSDRRLNALVRHLDSSAMDPNNNSSISASPTSAHAN SVFAHVVRAPEDPILGVTVAYNKDPSPAKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVND RSRVKEYLPIVGLADFNKLSAKLILGADSPPIQENRITTAQCLSGTGSLRVGGEFLAKHY HERTIYIPQPTWGNHTKVFTLAGLSVKSYRYYDPATRGLNFQGLLEDLRSAPAGAIVLLH ACAHNPTGVDPTLEQWEQIRQLVRSRGLLPFFDSAYQGFASGSLDADAESVRRFAADGGE CLIAQSYAKNMGLYGERVGALSIVCKTADVASKVESQLKLVIRPMYSNPPIHGASIVATI LKDRDLFNEWTIELKAMADRIISMRHQLFESLRAKGTPGDWSHIIKQIGMFTFTGLNSEQ VAFMTKEYHIYMTSDGRISMAGLSSRTVPHLTEAIHAAVTRVA


| Top |