Cherry SNP DataBase

Gene information

Gene Pav_sc0000800.1_g1290.1.br
Chromosome name PAV_r1.0chr1
start 33349825
end 33350838
PAV_r1.0 name Pav_sc0000800.1
start 785161
end 786174
direction +
Annotation NR PREDICTED: BURP domain-containing protein 3-like
Sequence CDS ATGTTGCAGCTCACACTGGTGGCAAGGGCAAGCTATGCTGCTGCTGCCAGAGACACCACC TCAACTTTACCACCTCAACTTCACTACTGGAACTCTGTCCTCCCAGGCACAACAATGCCA AAAGCTCTCAGTGAACTCGTCCAACCTGACTCAGTCGAACCACCCAAGAACTTTGTCGGT TACAACCACCACGCTGTCGAGGACAGAACCCTCGTTATCTACACCAAAAATGACGATACA AACCTGAAAGACCCAACCCAAAGAATTTTCTTCTTGGAGAAGGAAATAAAATCTGGCACA ACCATGAAATATAGCTTGGGTAGAAAAATAGCAGGGGAAACTTTCCTGCCCCGCAAAACT GCAGAATCGATCCCCTTCTCATCCGCCAAACTGCCAGAAATTCTCGACAAATTTTCTATG AAGCCGGGGTCTGTGGAAGCCGCTGTAATTCAGGAAACCATTCAAGATTGTGAAAGTGAA GTCCTTAGAGGAGAAGACAGATACTGCGCCACCTCCTTGGAGTCAATGGTTGACTTCGCC ATGTCCAAGCTGGGAAGAAACGTTCAAGCAATCTCGACAGAGGTCGAAAAGGGAGCCACC CTGCAGAACTACACAGTAAAGCCCGGCGTGAAGAAGGTGAACGAAGGTGGCAATTTCATT TTGTGTCACAAGCTGACCTACGCTTACGCTGTCTTCTTTTGCCACACATTTGGGCAAACT AGGGCTTATGCGGTGCCTCTGCAAGGTGCTGACGGAACGACCGCTAACGCAGTAGCAATC TGCCACCTGGACACATCTGCATGGAACCCCAAGAATCATCCCTTACAAGAGGTCAAAGTT AAGCCAGGAACCGTCCCGGTTTGCCATTATCTTCCCCAGGGTCATATTGCTTGGGTTCCA AACTAG
PEP MLQLTLVARASYAAAARDTTSTLPPQLHYWNSVLPGTTMPKALSELVQPDSVEPPKNFVG YNHHAVEDRTLVIYTKNDDTNLKDPTQRIFFLEKEIKSGTTMKYSLGRKIAGETFLPRKT AESIPFSSAKLPEILDKFSMKPGSVEAAVIQETIQDCESEVLRGEDRYCATSLESMVDFA MSKLGRNVQAISTEVEKGATLQNYTVKPGVKKVNEGGNFILCHKLTYAYAVFFCHTFGQT RAYAVPLQGADGTTANAVAICHLDTSAWNPKNHPLQEVKVKPGTVPVCHYLPQGHIAWVP N


| Top |