Cherry SNP DataBase

Gene information

Gene Pav_sc0000800.1_g570.1.mk
Chromosome name PAV_r1.0chr1
start 32894362
end 32898685
PAV_r1.0 name Pav_sc0000800.1
start 329698
end 334021
direction +
Annotation NR PREDICTED: probable ATP-dependent RNA helicase DHX37
Sequence CDS ATGAGCAAATCCCTGAAAAGAAAGCGCAACAGGTTGGAGGTTGAATCCAAAGATGCAAAA CGCAGGAAAGCTTTACAATTCCCAAAAGCTGGATTTAACAAGAATAATGGCGACTGTGCT TGTAGTGATCAAACTGAGCCTGGTCATCAGATAGAAAAAACTCAATCAAAGCATGATTTG GATGAGATTCATGAGGACAAAGTAAAAGAGAGTCCAAAAGTAAATTCCAGCAGCAGAGCA AGTGAATTATCAGAATTTCCTGCAGCAAGGCCTCCAATTGCACCAACTATAGTCCATGTA TCAAGGCCTGATGAAGTTGAAGAAACAAGGAAGGATCTTCCAATAGTAATGATGGAGCAG GAGATCATGGAGGCCATTAATGAAAATTCCACTGTGATTATACGTGGAGAGACTGGATGT GGTAAAACAACCCAAGTTCCTCAGTTTCTTTTTGAAGCGGGCTATGGTTCAAGCCACTCT AATTCTGCACGAAGTGGTATTATTGGTGTAACTCAACCCCGCCGTGTAGCAGCCTATGCG ACGGCTGAGCGAGTGGCGTATGAGCTTGGACTGAATTTAGGTAAAGAGGTCGGCTTTCAA GTTAGGCATGACAAAAGGATGAGTAAAAGTAGTTGCTCCATCAAATTCATGACAGACGGA ATATTACTACAAGAACTCAAGAGTGATTTTTTGTTGAAGCAATACTCTGTCATAATTCTT GATGAAGTTCATGTGCGGAGCTCGAACACCGACATACTTATCGGAATGCTTTCACGTGTT ATTGTACAGCGTCAGAAAGAATACGAAAACCAGCAAAAGGCGGTGCTTTTGGGAAAAAAC ATAAGTCGTGAACAACAGATTTTCCCTTTAAAGCTTGTGCTGATGAGTGCCACCTTGCGA GAAGACTTTATCAGAAAACTGTTTGGTGAGCCCCCGATCATAGAAGTTCCCACTAGACAA TTTTCAGTAAAAGCTTACTACGAAAACAGAACTGAGGAAGAAGGGGATTATGTTGAGAAA GCATGTAAAAAAGTCTTGAAGATTCACAAGAGACTACCACATGGAGGCATACTTGTGTTT GTCACTGGGAAGCGAGAAGTACAGCGCTTGTGTCAAAAGCTACAAGGAGCTTCAAGGGAA CTTATGAAAAGATCAGTTGAGAGTGATGCTGATGAAGTTTCTGATATTGATTCTGTTGAG GATGAGTTGGAGGGTTATTCATATGATTCAGAAACAGAAAGTGAACGAGAATTTTTTCAC GATGACGATAGGGATTCATTGTGCCAAGATACCCCAAGATTAGTTGATGGAAATGTGACA GAGGTTGCAGGAGAGGATGGTAGCATTGTATCACCTAAAGCCGGTTTCGATTCTTGGGCT AGAAAATCTTCATTGTTCTGTAATTCAGCTGGGAAAAAGGGTAGTTTTCCAGGCGCACTG CATGTTGTCCCTCTTTATGCCAGGCTGAATGCAGAAGCTCAACTTACAGAAATAGAAAAA GTGAAGGAGGGAGAACGGCTTGTTGTTGTAGCCACAAATGTGGCTGAAACCTCTTTAACT ATAAGCGGGATAAAGTATGTTGTTGATACTGGGAAAGAGAAAGTGAAGGACTACAATTCA AATGGCATGGAAACATATAAAATACAGTGGATTAGCAAGGCATCAGCTGATCAGCGTAAA GGAAGAGCTGGAAGAACAGGGCCTGGCCATTGTTACCGCCTGTATTCTCAAGCAGTGTAT TATAACAAATTCCCTGATTTTTCCGCACCTGAAATATCCGAAGTCCCCTTTGATGGTATA TCCAATTTTCCATTTCCAACTCCTCCAGAGGCTAGTGCTGTGGATGAAGCAGAGCGTCTC TTGACGGCCCTTGAAGCAAGTGACACAAATGGAAGATTAACACCTTTAGGGCATTCCATG GCTTGTTATCCCCTGCGTCCTCGCCACTCTCGGATGCTCCTTACGATTTTTCAAATCATG AGTAAACAGAAAAATCGTGCTCGAGCTAATTTGGTGTTAGCATATGCAGTTGCAGCAGTT GCATCTTTGAGTTGTTCAAATCCTTTTCTCAGGCAGTTTGAAGATATTCACACTACAAAC CATGACAATGTTTGCAGCGATGCGCCTTTGGAGCATTCAAATCAAGAGAAGTTGACAAAG AAGAAACTAAAAGAAACTCTAAAAGTGCCTCGTGAAAGGTTTTTCAATCCCAGCAGTGAT GCTCTGTCCAGAGCTTATGCTTTGCAGTGCTATGAAATATCCAAGAGGCCAGTGGAATTC TGCAATGACAATGCTCTGCACCCGAAAACCATGGAGGAAATATCCAAGCTGAGAAAGCAG CTCCTCGAACGTGTCTTTGAACAAAGTGGCTTTTCTGGTGGGGAGAAGGAATTTTCATGG ATCTATGGTAGCATGGAAGATGTAGAACGTGATTGGAGGGTTTCCTATGATAAGAACCCT CTTTCCTTGTATGAGGAAGAGCTCTTGGGCCAAGCCATCTGTGCTGGTTGGGCAGATAGG GTTGCTAAGCGCATTAGAGGAAGGAGTTCATCAGTGTCATCTGATTTAGGAGATCGAAAA GTTCGTGCTGTTCGATATCAAGCCTGCATGGTTAAAGAGACTGTGTTCCTCGACCCTTGG TCATCTGTTTCTAATTCAGCCCCTGAATTTCTGGTGTACAATGAGCTAATCCAGACAAGA TCAGGACCGTACATGTATGGCGTTACTCGTATAAAATCAGAATGGCTTGTTGAGCATGCC CGGGCTTTATGCACTTTCTCTGCACCCCCAACAGATACCAAACCTTACTACGAGCCTCTA ACTGATCAAATATTTCGTTATGTCATTCCAGCCTTCGGTTCTCATTTGTGGGAGCTTCCA CCATTTGGTTTGCCAATGAATAAATTTGATCAGTTTCGAGATCGAGTGAAAGCTTTTGCT TATGCTTTGCTTCAAGGCCAGGTTTTGCCTTGCTTAAAAGTTGTTCGTAAGTGTATGGCA GAACCTCCTGGTAATGTTTTAAAGCCGGAGGCAGCTGGTCGACGGAGGGTTGGGAATCTT TTAGAGAAGCTGATGAGAAACAAGATTCATAACTGCGCTGCGTTAAGACAGGTTTGGAAG GAGAATCGCATGGAGTTGCATCCAGAATTCCTGGCCTGGTTTAATAAGAGTTTCCAAACT AGCAGCTTTGAAGCCCTTTGGTCACTCATGCTTCGTGAAGTTCTTTAG
PEP MSKSLKRKRNRLEVESKDAKRRKALQFPKAGFNKNNGDCACSDQTEPGHQIEKTQSKHDL DEIHEDKVKESPKVNSSSRASELSEFPAARPPIAPTIVHVSRPDEVEETRKDLPIVMMEQ EIMEAINENSTVIIRGETGCGKTTQVPQFLFEAGYGSSHSNSARSGIIGVTQPRRVAAYA TAERVAYELGLNLGKEVGFQVRHDKRMSKSSCSIKFMTDGILLQELKSDFLLKQYSVIIL DEVHVRSSNTDILIGMLSRVIVQRQKEYENQQKAVLLGKNISREQQIFPLKLVLMSATLR EDFIRKLFGEPPIIEVPTRQFSVKAYYENRTEEEGDYVEKACKKVLKIHKRLPHGGILVF VTGKREVQRLCQKLQGASRELMKRSVESDADEVSDIDSVEDELEGYSYDSETESEREFFH DDDRDSLCQDTPRLVDGNVTEVAGEDGSIVSPKAGFDSWARKSSLFCNSAGKKGSFPGAL HVVPLYARLNAEAQLTEIEKVKEGERLVVVATNVAETSLTISGIKYVVDTGKEKVKDYNS NGMETYKIQWISKASADQRKGRAGRTGPGHCYRLYSQAVYYNKFPDFSAPEISEVPFDGI SNFPFPTPPEASAVDEAERLLTALEASDTNGRLTPLGHSMACYPLRPRHSRMLLTIFQIM SKQKNRARANLVLAYAVAAVASLSCSNPFLRQFEDIHTTNHDNVCSDAPLEHSNQEKLTK KKLKETLKVPRERFFNPSSDALSRAYALQCYEISKRPVEFCNDNALHPKTMEEISKLRKQ LLERVFEQSGFSGGEKEFSWIYGSMEDVERDWRVSYDKNPLSLYEEELLGQAICAGWADR VAKRIRGRSSSVSSDLGDRKVRAVRYQACMVKETVFLDPWSSVSNSAPEFLVYNELIQTR SGPYMYGVTRIKSEWLVEHARALCTFSAPPTDTKPYYEPLTDQIFRYVIPAFGSHLWELP PFGLPMNKFDQFRDRVKAFAYALLQGQVLPCLKVVRKCMAEPPGNVLKPEAAGRRRVGNL LEKLMRNKIHNCAALRQVWKENRMELHPEFLAWFNKSFQTSSFEALWSLMLREVL


| Top |