Cherry SNP DataBase

Gene information

Gene Pav_sc0000813.1_g080.1.mk
Chromosome name PAV_r1.0chr7
start 14403757
end 14410126
PAV_r1.0 name Pav_sc0000813.1
start 50010
end 56379
direction +
Annotation NR PREDICTED: aconitate hydratase 1
Sequence CDS ATGGCGACGGCGAATCCATTTCAGAAGATACTGACGGCGCTTGAGAAGCCAGACGGTGGT GAATTCGGAAAATACTACAGCTTACCAGCTCTCAATGATCCTAGAATTGACAAGCTGCCA TTCTCTATCAAGATCCTTCTTGAATCAGCAATCCGTAACTGTGACGAGTTTCAGGTTAAG AGTAAGGATGTTGAGAAAATTATTGATTGGGAGAACACATCTCCCAAGCAGGTTGAGATC CCATTCAAACCTGCTAGAGTTCTTCTTCAGGATTTTACTGGGGTACCTGCTGTTGTTGAT CTGGCTTGCATGAGAGATGCCATGAACAATCTAAAGGGCGATTCTAACAAGATTAACCCA TTGGTCCCCGTAGATCTTGTTATTGATCACTCAGTTCAGGTAGATGTGGCAAGATCAGTA AACGCAGTGCAGGCAAATATGGAACTCGAGTTCCAGAGAAACAAAGAACGGTTTGGTTTT CTGAAATGGGGATCAAATGCATTCCATAACATGCTTGTTGTTCCTCCTGGATCAGGGATT GTTCACCAGGTTAATTTGGAATACCTTGGTCGAGTCGTGTTCAACACAGATGGCTTGCTT TATCCTGATAGTGTGGTTGGGACCGATTCTCACACAACAATGATTGATGGATTAGGTGTT GCTGGATGGGGAGTGGGTGGGATCGAAGCAGAAGCCACAATGCTTGGCCAGCCCATGAGC ATGGTCCTGCCTGGTGTGGTTGGGTTTAAATTACTAGGAAAACTGAGAGATGGTGTGACA GCTACTGACTTGGTTCTGACAGTTACTCAAATGCTGAGGAAGCATGGAGTTGTCGGCAAG TTTGTGGAGTTCTATGGAGAAGGCATGAGTGAATTGTCACTAGCAGACCGTGCCACAATT GCCAACATGTCTCCCGAGTATGGTGCGACCATGGGCTTCTTTCCTGTGGATCGTGTCACG TTGCAATATCTGAAACTAACAGGCAGAAGTGATGACAAGGTTGCTCTGATAGAATCCTAT TTACGGGCTAATAGGATGTTTGTCGACTACAATGAGCCCCAGGTTGAGAGAGTGTACTCC TCTTATCTGGAGCTAAATCTTAATGAAGTGGAACCATGCATATCAGGTCCAAAGAGGCCA CATGATCGTGTTACTTTGAAAGAAATGAAAGTGGATTGGCACGCATGCCTTGACAATAGA GTTGGATTTAAGGGTTTTGCTGTGCCGAAGGAATCTCAAAATAAAGTTGTAGAGTTCACA TTTCACGGAACCCCAGCTCAGCTAAGGCATGGGGATGTAGTTATAGCAGCTATCACCAGT TGCACAAACACCTCAAATCCTAGTGTAATGCTTGGAGCTGCTTTGGTTGCAAAGAAAGCT TGTGAATTAGGATTGGAGGTCAAGCCATGGATTAAGACAAGTCTTGCTCCGGGTTCTGGG GTTGTAACCAAATACTTGCAAAAGAGTGGGTTGCAGCAGTATTTGAATCAGTTAGGGTTT CATATTGTTGGGTATGGATGCACCACATGCATTGGGAATTCAGGAGATATTGATGATGCT GTGGCATCAGCTATTACAGAAAATGATATTGTAGCTGCGGCTGTGTTGTCTGGAAATAGG AATTTTGAGGGTCGTGTGCATCCTTTAACAAGGGCCAATTATCTTGCTTCTCCTCCCCTT GTTGTTGCCTATGCTCTTGCTGGAACGGTAGATATTGATTTCGAAACAGAACCAATTGGG TTGGGAAAAGATGGTAAGAAGATATTTTTCAGGGACATTTGGCCATCTAATGAAGAAGTA GCAGAGGTTGTGCAATCAAATGTGCTTCCTCATATGTTTATGGCTACATACGAAGCAATC ACCAAAGGAAATCCAATGTGGAATCAGTTATCTGTACCGGATGGCACTCTTTATGCCTGG GACCCAAAATCAACTTATATACATGAGCCACCTTATTTCAAAGATATGACCATGTCTCCT CCGGGCGCTCATGGAGTGAAGAATGCTTACTGCTTGCTCAACTTTGGAGATAGTATCACA ACTGACCACATCTCACCTGCTGGTAGCATCCACAAAGACAGTCCAGCAGCCAAATACCTT CTGGAACGTGGTGGTGTGAAGGCAGTCATAGCAAAGAGCTTTGAGCGCATTCACCGCAGT AATCTTGTGGGCATGGGCATCATTCCACTATGTTTTAAGACTGGGGAAGACGCAGACACT CTGGGGTTAACCGGTGAGGAACGTTACACCATCGATCTTCCAAGCAGTGTTGGCGAAATT AAACCCGGACAGGATGTTACAGTGGTGACAGATAATGGCAAATCCTTCGTATGTACACTA CGATTCGATACAGAGGTCGAGCTGGCATATTTTGATCATGGAGGCATTTTGCAATATGTC ATCAGGAATCTGATCAAAAGCTAG
PEP MATANPFQKILTALEKPDGGEFGKYYSLPALNDPRIDKLPFSIKILLESAIRNCDEFQVK SKDVEKIIDWENTSPKQVEIPFKPARVLLQDFTGVPAVVDLACMRDAMNNLKGDSNKINP LVPVDLVIDHSVQVDVARSVNAVQANMELEFQRNKERFGFLKWGSNAFHNMLVVPPGSGI VHQVNLEYLGRVVFNTDGLLYPDSVVGTDSHTTMIDGLGVAGWGVGGIEAEATMLGQPMS MVLPGVVGFKLLGKLRDGVTATDLVLTVTQMLRKHGVVGKFVEFYGEGMSELSLADRATI ANMSPEYGATMGFFPVDRVTLQYLKLTGRSDDKVALIESYLRANRMFVDYNEPQVERVYS SYLELNLNEVEPCISGPKRPHDRVTLKEMKVDWHACLDNRVGFKGFAVPKESQNKVVEFT FHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSG VVTKYLQKSGLQQYLNQLGFHIVGYGCTTCIGNSGDIDDAVASAITENDIVAAAVLSGNR NFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFETEPIGLGKDGKKIFFRDIWPSNEEV AEVVQSNVLPHMFMATYEAITKGNPMWNQLSVPDGTLYAWDPKSTYIHEPPYFKDMTMSP PGAHGVKNAYCLLNFGDSITTDHISPAGSIHKDSPAAKYLLERGGVKAVIAKSFERIHRS NLVGMGIIPLCFKTGEDADTLGLTGEERYTIDLPSSVGEIKPGQDVTVVTDNGKSFVCTL RFDTEVELAYFDHGGILQYVIRNLIKS


| Top |