Cherry SNP DataBase

Gene information

Gene Pav_sc0000813.1_g180.1.mk
Chromosome name PAV_r1.0chr7
start 14454460
end 14460947
PAV_r1.0 name Pav_sc0000813.1
start 100713
end 107200
direction +
Annotation NR PREDICTED: probable serine/threonine-protein kinase drkD
Sequence CDS ATGGCTATTGATGAAGACGTAGAGAGCTGTGGCAGCAGAGCCGCGCTCTCGTCCCACGCT CAGCCTCGCCATCAGAGACAGAAGCTCGAGGTTTACAACGAGGTGCTTCGGCGAATCCAA CAGTCCAATTTTGAGGAGGCTAATCTTCTCGGATTTGATGATCAGCTTTGGCTTCATTTC AATCGCTTACCTGCTCGATATGCATTGGATGTGAACGTGGAGAGGGCAGAAGATGTGCTT ACACATAAGAGATTGCTGCAATTTGCAGAAGACCCTGCTAATCAACCTGCCTTCGAAGTT CGCACTGTGCAGGTCTATCATGTCGGAAACTCTGTTGATTCGGTCCATTCAGATTCTTCA ATGATAGAAGATGCACAAAGTTCTTTTAATTATTCTAACAGACAAGGGATCCATCCACCA CCTACCTTTGGTTCATCTCCTAATCTTGAAGCATTTGCACTTCAAGCAAATAGATACCAT GTTGAAGATGGAGGTAGTGCAGTGAGTTCAACACCATTCTTTTCTAGGCCTATGCATGAG ATCACGTTTTCAACAGTTGACAAGCCCAAACTTCTTAGTCAGTTAACTTCATTACTTGCT GAGATTGGACTGAATATTCAAGAAGCTCATGCTTTTTCCACTGTCGATGGATTTTCTCTG GATGTTTTCGTGGTCGATGGTTGGCACTATGAGGAAACCGAGGAGCTTAAAAGTGTGCTG CAAAAGGAAATTTCAAAATTAAAGGAGCAATCTTGGTCAAAACAACATCCAATTGCTGCT ATTGGCGAGGACAACCAAACAAGGAATGAGTCTTTCCCAGATTGCATAGAAATACCAACT GATGGAACAGATGTCTGGGAGATTGATACGAGGCAGCTGAAATTCGAGAACAAAGTTGGA TCTGGGTCATTCGGTGATCTGTACAGAGGCTCATATTGTAGTCAGGAGGTTGCCATAAAA GTTCTCAAACCGGAGCGCGTCAATGCAGAGATGCTGAGAGATTTTTCACAGGAAGTTTAT ATACTGAGGAAGATTCGGCACAAGAATGTTGTGCAATTTATAGGTGCATGTACAAAGCCT CCAAACCTATGCATTGTGACAGAATTTATGTCCAGAGGAAGTGTGTACGACTTTCTGCAT AAACATAGGGGTGTGTTTAAGCTTCCCTCTCTGCTCAAAGTAGCAATTGATGTTTCCAAG GGAATGAACTATTTGCACCAAAATAATATAATCCACAGGGATCTTAAGACGGCCAATCTT CTGATGGATGAACACGAAGTCGTTAAGGTTGCTGATTTTGGCGTTGCCAGAGTGCAGACT CAGTCTGGAGTGATGACAGCTGAAACTGGAACATACCGCTGGATGGCTCCAGAGGTCATT GAACACAAACCATATGATCACAAGGCAGATGTTTTCAGTTTTGGAATAGTACTGTGGGAG CTTCTAACAGGACAACTCCCTTACTCATCGTTGACCCCATTACAAGCAGCAGTAGGTGTG GTGCAAAAGGCCTTACGACCTACAATTCCCAAGACCACTCACCCAAGGTTTGCCGAACTG CTTGAGAGATGCTGGCAGCAAGACCCAACTCAAAGACCCCACTTCTCCGATATTGTAGAA ATCCTGCAGAATTTGGCCAAGGAGGTCGGAACTGAGGGAGAAGATCGACGTAAGGATAAA TCAGGTGGTTTTTTCTCGGGACTGAGATGGGGCCATCACTGA
PEP MAIDEDVESCGSRAALSSHAQPRHQRQKLEVYNEVLRRIQQSNFEEANLLGFDDQLWLHF NRLPARYALDVNVERAEDVLTHKRLLQFAEDPANQPAFEVRTVQVYHVGNSVDSVHSDSS MIEDAQSSFNYSNRQGIHPPPTFGSSPNLEAFALQANRYHVEDGGSAVSSTPFFSRPMHE ITFSTVDKPKLLSQLTSLLAEIGLNIQEAHAFSTVDGFSLDVFVVDGWHYEETEELKSVL QKEISKLKEQSWSKQHPIAAIGEDNQTRNESFPDCIEIPTDGTDVWEIDTRQLKFENKVG SGSFGDLYRGSYCSQEVAIKVLKPERVNAEMLRDFSQEVYILRKIRHKNVVQFIGACTKP PNLCIVTEFMSRGSVYDFLHKHRGVFKLPSLLKVAIDVSKGMNYLHQNNIIHRDLKTANL LMDEHEVVKVADFGVARVQTQSGVMTAETGTYRWMAPEVIEHKPYDHKADVFSFGIVLWE LLTGQLPYSSLTPLQAAVGVVQKALRPTIPKTTHPRFAELLERCWQQDPTQRPHFSDIVE ILQNLAKEVGTEGEDRRKDKSGGFFSGLRWGHH


| Top |