Cherry SNP DataBase

Gene information

Gene Pav_sc0000813.1_g460.1.mk
Chromosome name PAV_r1.0chr7
start 14571708
end 14576994
PAV_r1.0 name Pav_sc0000813.1
start 217961
end 223247
direction +
Annotation NR PREDICTED: rab proteins geranylgeranyltransferase component A 2
Sequence CDS ATGATATGGAACTGCCTAAATACTTGGTCCTATTGCCTAGAAATGACTAATGTTAGGTCG CGAAGACAGGGGAAAAGGTTGCTACATGCAGCCATGAATGCTCTTCTCACCCTTCCTGTT TCTGCGAATCCTGAAAGTGGTTCTGCAGCTGGTAGTGAAGATGCAGAAGTAAAACCCACC CTGCTTTGGAGCAGGTTATACATTCAGGAGCTCACAACGTTGCCCACTGGTCAATATGAA AATATCATCTCCACTCCGATGCTAGATGGAAATATTAACTTCAGTGATCTGATAGAATCA ACTGTGGTGCTTTTCCAGAAGATGTATCCAGATGAGGTATTCTTTCCGGAGACACCCTCC TCCCCTGAGGTGCCTGAGAATTCAGAGGATGGTACTGAGCTTAGCAATATTCTTCTTTGA
PEP MIWNCLNTWSYCLEMTNVRSRRQGKRLLHAAMNALLTLPVSANPESGSAAGSEDAEVKPT LLWSRLYIQELTTLPTGQYENIISTPMLDGNINFSDLIESTVVLFQKMYPDEVFFPETPS SPEVPENSEDGTELSNILL


| Top |