Cherry SNP DataBase

Gene information

Gene Pav_sc0000815.1_g080.1.mk
Chromosome name PAV_r1.0chr7
start 245477
end 254937
PAV_r1.0 name Pav_sc0000815.1
start 60489
end 69949
direction -
Annotation NR PREDICTED: probable vacuolar amino acid transporter YPQ1
Sequence CDS ATGCAATACTATACAGTGATGGGAGGAATGGCAGTGGGGCCCACGAGAGATGAGCATTGT TGGGAATGGGGGAGGAAGTACATGGAGTATAATCTTTGCAGCGTCAAAGACGGCGTTTCG CTGACACTGGGTTTAGTCAGTGTGGTGAGTTGGGGTGTTGCTGAGATACCTCAAATCATC ACAAACTACAAAAACAAATCCACGAACGCAGCTCTGTATTACTTCGGTGCCTGA
PEP MQYYTVMGGMAVGPTRDEHCWEWGRKYMEYNLCSVKDGVSLTLGLVSVVSWGVAEIPQII TNYKNKSTNAALYYFGA


| Top |