Cherry SNP DataBase

Gene information

Gene Pav_sc0000825.1_g210.1.mk
Chromosome name PAV_r1.0chr7
start 7428583
end 7435041
PAV_r1.0 name Pav_sc0000825.1
start 88011
end 94469
direction -
Annotation NR hypothetical protein B456_004G071800
Sequence CDS ATGGTGTTCAATTCAGTCTCTTCCCGCCCCGAAACCATACCCGAGCCCGCCCCGAAACCC GATTCCATGGCCTCCATTGTGCCTTCCAAGTCTCTTGTCCACCAAGCCCAAAACCATGGC CTCCCTTTGCCCCAGTTGAAATGGGCCATGAGCAACAACACCACCACCACCACCAAAAGC AACGAAACCAACAAGACCAGCGCGAAAAGCAGCGAAAATAACAACCCTTCTCTGCAACTG AGCAGCAACACCAAATTCGCACAGCTTGACCCGGTAGCTAAGCAGCCCGAGCCCAAGTTC TGCAATGTCGAAAAAGAAGCCGACCCACTTCCCGCCACGGAAGTGATCGACGGCCCGGAG ACCCAGAAGCCAAAATCGACGGCTGAGGATAAGAAATCGAAGATTTGCATCCGGATTCGG AGCAAAGAAAAGGCTGCTGTGGTGCCTGAGCCTGAACCTGAACCTGAACAAGTAAATGAA AAAGAGAGCTCTGTTGCTGCTGCTTTAGCAGCGCTGGAGGATGAAGAGACGATTCAGAAG ACTTGGAATCTCAGGCCCAGGAGACCGGTGCCTAAGGCCAATGGTCGTGCTGGTGCATTG AAGACTGGTGCACCGCTGGTGCAGCAGAACAAAACCCAGGTGGCTGGGGGCTCTTCTAAA GCTGGAGCCAAAGATGCTCAAAAGGACAATAAACTGAAGATATCGGTTTCTTTAACAAAA GAAGAGATTGAGGAGGACATTTTTATTATGACTGGAGCCAGGCCATCCAGGCGCCCAAAG AAGAGAGCTAAGAATGTGCAGAAACAGCTTGATCATCTGTTTCCTGGGTTGTGGCTGAAT TCAGTATCTACCAATTCCTACCAGGTTCCTGAAACTCCATTGAAGGTGAAATCTTATGAA TCCTTTGAGAATTTGAATGTGCTGCTTTCAGGATTAGATGGGATGAGGCTGCTGTTAGTT AAATGTTTGGTGGTGATTTTGAAGACTTGTGAACTGCTCTAA
PEP MVFNSVSSRPETIPEPAPKPDSMASIVPSKSLVHQAQNHGLPLPQLKWAMSNNTTTTTKS NETNKTSAKSSENNNPSLQLSSNTKFAQLDPVAKQPEPKFCNVEKEADPLPATEVIDGPE TQKPKSTAEDKKSKICIRIRSKEKAAVVPEPEPEPEQVNEKESSVAAALAALEDEETIQK TWNLRPRRPVPKANGRAGALKTGAPLVQQNKTQVAGGSSKAGAKDAQKDNKLKISVSLTK EEIEEDIFIMTGARPSRRPKKRAKNVQKQLDHLFPGLWLNSVSTNSYQVPETPLKVKSYE SFENLNVLLSGLDGMRLLLVKCLVVILKTCELL


| Top |