Cherry SNP DataBase

Gene information

Gene Pav_sc0000830.1_g070.1.mk
Chromosome name PAV_r1.0chr4
start 22942760
end 22945773
PAV_r1.0 name Pav_sc0000830.1
start 22465
end 25478
direction +
Annotation NR PREDICTED: cysteine-rich receptor-like protein kinase 25
Sequence CDS ATGCCTTCCTTCAATCTCAGTGTGTTGATGACCCTTGTGCTTGGCTTGCTTAGCCTTAGC AGTTTGAGTGAAGCTGAATACCGCTACCACGTCTGTTCTAACACAACCAGTTTCACTCCC AACAGCACCTACGAATTCAATCTTAAGCTCCTCCTCTCTTCTCTCACCTCCAACGCCACC CGTGAACTCGGTTTCTACAACACCACTGCCGGCTCCCAAGATCCCAACGCTGCAGTTTAC GGTTCCTTTCTATGCCGTGCTGATCTCACATCCGATGCATGCCAAGATTGTGTAGCCACC GCAGCCAGAGAAACGGTCAAAGAGTACTGCCCCTTAAGAAAAGTCACTATAATTTGGTAC GATGATTGCATGTTACGCTACTCAAACATGTCTTTTTTCGGCAATATGGATAAAGCCCCA AGTGTTTATTTGTGGAACGTGGGAAACATAACTGATCCAAACCGGTTTAATCAGGTGCTG GTGGATACAATCACTGGCTTGGTGTCTGTGGCAGCAAATGCGGCCTCCGGTGCTAAAAAG TTTGCGACAAAAGAAGCAAACATTACAGGGTTTCAGGAGTTGTACATCCTTGTGCAGTGC ACGCCGGACCTGTCAAGCACCGCCTGTCATTGGTGTCTTCTTGGAGCTATTACACTTCTT CCGGATTGTTGTGAATGGAAGCAAGGGGGAAGAGTTTTGTATCCTAGTTGTAATGTTAGA TATGAAATGTATCCATTTTATACGATAGTTGCTGCCCCTCCTCTACCACTGCTTCTTCCT CCTCCACCTCCGGCAAGGTCTCAAGGAGGAAGAAGCAGATTTTCTCCTTCCATAATCATT GTCACCAGTATTCTTGCTCTTGTTGCCGTCTCTGTGTTACTTGTAGCTTTCTACTGCTTC GCACGGAGAACATCAGTAAGAGACGAGTACAATACTGCCCCAAGTCAAGAAAATGCTTTC TATTGCTTCGCACGCAGAAGATCAGTAAGAGACGAGTACAGTAACAGTACTGCCCCAAGT CAAGAAAACGTTGGGAATGATACAAACAGTGTCGAGTCCTTGCAATTTGACTTGGGAACT ATTGAAACTGCCACCAGCAAGTTTTCTGACAATAACAAGTTAGGTGAAGGCGGATTTGGT GTCGTCTTCAAGGTATGA
PEP MPSFNLSVLMTLVLGLLSLSSLSEAEYRYHVCSNTTSFTPNSTYEFNLKLLLSSLTSNAT RELGFYNTTAGSQDPNAAVYGSFLCRADLTSDACQDCVATAARETVKEYCPLRKVTIIWY DDCMLRYSNMSFFGNMDKAPSVYLWNVGNITDPNRFNQVLVDTITGLVSVAANAASGAKK FATKEANITGFQELYILVQCTPDLSSTACHWCLLGAITLLPDCCEWKQGGRVLYPSCNVR YEMYPFYTIVAAPPLPLLLPPPPPARSQGGRSRFSPSIIIVTSILALVAVSVLLVAFYCF ARRTSVRDEYNTAPSQENAFYCFARRRSVRDEYSNSTAPSQENVGNDTNSVESLQFDLGT IETATSKFSDNNKLGEGGFGVVFKV


| Top |