Cherry SNP DataBase

Gene information

Gene Pav_sc0000832.1_g650.1.mk
Chromosome name PAV_r1.0chr3
start 20646966
end 20668497
PAV_r1.0 name Pav_sc0000832.1
start 365636
end 387167
direction -
Annotation NR PREDICTED: phospholipid-transporting ATPase 2
Sequence CDS ATGAAGCGCTACATCTACATCAATGACGATGAATCATCGCACCATCTTTACTGCGACAAT CGCATATCAAATAGAAAGTATACTTTGTTGAACTTTCTCCCAAAGAATTTATGGGAACAG TTCAGCCGCTTCATGAATCAGTATTTTTTGCTGATTGCTTGTCTTCAGCTATGGTCACTT ATTACTCCAGTAAATCCTGCCAGTACATGGGGCCCACTTATCTTCATTTTTGCAGTCTCT GCGACGAAAGAGGCATGGGATGATTACAACAGATATCTCTCAGACAAGAAGGCAAATGAG AAAGAAGTTTGGGTTGTTAGGCAAGGCATCAAGAAGCATATACAAGCGCAAGATATTCAT GTTGGTAACATAGTTTGGCTTCGAGAGAATGATGAGGTGCCATGTGATCTTGTTTTGATT GGCACCTCAGAAGCACAAGGCCTGTGCTATGTAGAGACTTCTGCCCTAGATGGAGAAACT GATCTGAAGACCAGGGTTATACCCCCAGCTTGCATGGGGATAGATCTTGAATTGTTGCAC AAAATTAAGGGTTTAATTGAGTGTCCTAATCCTGATAAGGACATCAGAAGATTTGATGCA AATCTGCGGTTGTTTCCCCCATTTATTGATAACGACCTGTGCCCATTAACCATAAAAAAC ACACTACTTCAGTCATGTTACTTGCGGAATACAGAGTGGGCCTGTGGGGTAGCAGTCTAC ACTGGCAATGAAACCAAGCTGGGTATGAGTAGGGGCATACCTGAGCCAAAGCTTACAGCT GTTGATGCCATGATTGACAAGTTGACTGGAGCTATATTTGTTTTCCAAATAGTGGTGGTG ATGGTTCTGGGCGTTGCTGGTAATGTATGGAAAGATACAGAAGCAAGGAAGCAATGGTAT GTTTTATACCCAGAGGAAGGTCCGTGGTACGAACTATTAGTAATCCCTCTTCGATTTGAA CTACTATGTTCCATCATGATACCCATATCTATTAAGGTATCTCTTGACCTTGTGAAGAGT TTGTATGCGAAGTTTATTGATTGGGATAATGAAATGATTGACCAAGAAACGTGTACTCCA GCCCATGCAACAAATACAGCAATAAGTGAAGACCTGGGACAAGTAGAGTACATTTTGACT GACAAAACGGGTACCTTAACCGAAAACAAAATGATATTTAGAAGATGTTGTATCAATGGA ATTTTCTATGGGAATGAAAATGGGAATGCCTTGAAAGATGAGGAGCTCATAAATGCTGTT GCCAGTGGTTCTTCTGATGTTATACGTTTCCTTACAGTTATGGCAGTATGTAATACAGTC ATACCTGTTCGAAGCAAAAGTGGAAGTATCTTGTACAAGGCGCAATCTCAAGATGAGGAT GCTCTTGTTCATGCTGCAGCTCTGCTACATATGGTTTTTGTCAATAAAAATTCAAATACT CTTGAGATCAAGTTCAATGCTTCTACAATTCAATATGAAGCCCTGGAAATTCTGGAGTTC ACTTCTGATCGGAAAAGAATGTCAGTAGTGGTGAAGGATTGCCAAAATGGAAGGATTATC CTTTTGTCAAAAGGAGCAGATGAAGCAATTCTCCCTTATGCATCCGCTGGACAGCAAACA AGGACATTTATTGAAGCTGTTGACCAATATGCTCAATTGGGATTGCGCACGCTATGTCTT GCTTGGCGTGAACTAAAAGAAGAGGAATATCGAGAATGGTCTTTGATGTTTAAAGAGGCT AGCAGCACATTGGTTGATAGGGAGTGGAGACTAGCTGAGGTCTGTCAAAGATTAGAACAT GACTTTGAAGTTCTTGGAGTTACTGCCATAGAGGATCGCCTACAGGATGGTGTACCGGAG ACAATTGAGACCCTGAGAAAAGCTGGTATAAATTTTTGGATGCTGACCGGAGACAAACAG AATACTGCCATTCAGATTGCTCTTTCATGCAATTTCATTTCCCCAGAGCCAAAAGGTCAG CTTTTGTTAATTGATGGCAAAACTGAAGATGAAGTGCGTAGAAGTTTAGAGAGAGTTTTA CTTACAATGAGGATAACAACTTCAGAACCTAAGGATGTGGCATTTGCCATTGATGGCTGG TCCCTTGAAATTGCACTGAAGCATTATCGGAAAGATTTTACTGAATTAGCAATATTGTCA AGGACTGCTATATGCTGTCGCGTAACGCCATCACAAAAAGCTCAGCTTGTGGAGATTTTA AAATCATGCGATTATAGAACATTGGCTATTGGGGATGGTGGAAATGATGTTAGGATGATA CAACAAGCTGACATTGGGGTTGGAATTAGTGGGAGAGAAGGACTGCAAGCAGCTAGGGCA GCTGATTATAGTATCGGGAAGTTCAGGTTTCTGAAAAGATTAATACTTGTGCATGGGCGT TACTCATACAACCGTACCGCATTTCTCTCCCAGTATTCTTTTTATAAGTCTCTGGTTGTC TGCTTCATCCAAATTTTTTTCTCTTTTGTTTCAGGTGTCTCTGGAACCAGTCTTTTCAAT TCTGTTAGCTTGATGGCTTATAATGTTTTCTACACCAGTGTTCCTGTTCTAGTCAGTGTT CTTGATAAAGATCTTAATGAAGATACTGTGATGCAGCATCCACAAATTTTATTTTACTGC CAAGCGGGGAGGCTTTTGAACCCGAGTACATTTGCTGGATGGTTTGGGCGATCCCTTTTC CATGCAATTGTTGTGTTTGTGATCAGCATACATGCCTATGCTTATGAAAAAAGTGAAACG GAGGAGGTTTCAATGGTAGCGCTTTCTGGATGTATTTGGTTGCAGGCATTTGTAATGACA TTAGAGACAAATTCCTTTACAATATTGCAACATCTTGCTGTATGGGGAAACTTAGCTGCC TTCTATATCATCAACTGGATCTTCAGTGCCATTCCATCATCAGGGATGTATACAATTATG TTTCGCTTGTGTAGACAGCCATCTTATTGGATGACAATGTTGCTCATAGTTGCAGCAGGG ATGGGTCCGATTCTAGCGCTGAAGTACTTCCGGTATACTTACAGACCAAGCAAAATCAAT ACACTTCAGCAGGCTGAACGGTTGGGAGGGCCTATCCTGTCGATTGGGAGCATTGAACCA CAACCAAGAACCATAGAAAATGATGTTTCTCCGTTATCAATAACTCAACCCAAGAACAGA AATCCAATTTTTGAACCTCTACTATCAGATTCACCAAATTCTACTAGAAGGTCTTTTGGT TCAGGAGCACCTTTCGATTTCTTTCAATCCCAGTCCAGATTGTCTACTTCCAACTACTCA AGAAATTGTAAGGACAACTGA
PEP MKRYIYINDDESSHHLYCDNRISNRKYTLLNFLPKNLWEQFSRFMNQYFLLIACLQLWSL ITPVNPASTWGPLIFIFAVSATKEAWDDYNRYLSDKKANEKEVWVVRQGIKKHIQAQDIH VGNIVWLRENDEVPCDLVLIGTSEAQGLCYVETSALDGETDLKTRVIPPACMGIDLELLH KIKGLIECPNPDKDIRRFDANLRLFPPFIDNDLCPLTIKNTLLQSCYLRNTEWACGVAVY TGNETKLGMSRGIPEPKLTAVDAMIDKLTGAIFVFQIVVVMVLGVAGNVWKDTEARKQWY VLYPEEGPWYELLVIPLRFELLCSIMIPISIKVSLDLVKSLYAKFIDWDNEMIDQETCTP AHATNTAISEDLGQVEYILTDKTGTLTENKMIFRRCCINGIFYGNENGNALKDEELINAV ASGSSDVIRFLTVMAVCNTVIPVRSKSGSILYKAQSQDEDALVHAAALLHMVFVNKNSNT LEIKFNASTIQYEALEILEFTSDRKRMSVVVKDCQNGRIILLSKGADEAILPYASAGQQT RTFIEAVDQYAQLGLRTLCLAWRELKEEEYREWSLMFKEASSTLVDREWRLAEVCQRLEH DFEVLGVTAIEDRLQDGVPETIETLRKAGINFWMLTGDKQNTAIQIALSCNFISPEPKGQ LLLIDGKTEDEVRRSLERVLLTMRITTSEPKDVAFAIDGWSLEIALKHYRKDFTELAILS RTAICCRVTPSQKAQLVEILKSCDYRTLAIGDGGNDVRMIQQADIGVGISGREGLQAARA ADYSIGKFRFLKRLILVHGRYSYNRTAFLSQYSFYKSLVVCFIQIFFSFVSGVSGTSLFN SVSLMAYNVFYTSVPVLVSVLDKDLNEDTVMQHPQILFYCQAGRLLNPSTFAGWFGRSLF HAIVVFVISIHAYAYEKSETEEVSMVALSGCIWLQAFVMTLETNSFTILQHLAVWGNLAA FYIINWIFSAIPSSGMYTIMFRLCRQPSYWMTMLLIVAAGMGPILALKYFRYTYRPSKIN TLQQAERLGGPILSIGSIEPQPRTIENDVSPLSITQPKNRNPIFEPLLSDSPNSTRRSFG SGAPFDFFQSQSRLSTSNYSRNCKDN


| Top |