Cherry SNP DataBase

Gene information

Gene Pav_sc0000843.1_g540.1.mk
Chromosome name PAV_r1.0chr3
start 1303889
end 1313052
PAV_r1.0 name Pav_sc0000843.1
start 260175
end 269338
direction -
Annotation NR ATPase 10, plasma membrane-type -like protein
Sequence CDS ATGTTACCACAGGCTTCTTCCCCGGGGCACTTAGTTTCATCATCTTCCAGGCCCAATGAT GTTCATTTTTCCTCAGTTTCCCCTTGTGAAAGGCGTTCCCAAAATTCTCCATTCATTTTT AAATTACCAGTTGATGAAAAATCATTGTCACTGACACATTCTTCCCATTCAGAAGTACAA CCTACAGCATTGATTAATTACTCGGAAGAAAATAAAGATATTTCCTGGTACCCAGATTCA CTTCAGGAATTTCTTCATTTCCCTGAAAATGTCCCTGACCAGAATGGCCTGGTGGATAGT AGTGCTGGTGTCATAACATCTGAGGATCATGCTGAAAAGACCGATTGGTCTGATTGGGAT CCATTAATTTCCTTTGATGATGCTCTGGACCCAAACTGGGAGCTTCCCATTGATGTTGAT GCAGTGGATCCCAAACCAAAGGTGGAGCTCCAAAAGCGGCTTCACGAACAACTTGAGGAA CGCTTACCATTGGAAGAAGTTTTCGAACAACTGAGGACATCACCGCAAGGACTTTCATCC GAAGATGCTGAAGCCAGATTGAAGATTTTTGGCTTTAACAAGCTTGAAGAGAAGACGGAG AACAAATTTTTGAAGTTTCTTAGTTTCATGTGGAACCCCTTGTCATGGGTTATGGAAGCT GCAGCAATTATGGCACTTGTCCTTGCTAATGGTGGAGGCGAGGGTCCTGACTGGCAGGAC TTTGTGGGGATTATTATCCTGTTAATAATCAATTCAACAATTAGTTTCATAGAGGAGAAC AATGCAGGGAATGCTGCATCGGCTCTTATGGCTCGTTTAGCTCCGAAGACAAGGTCAGCT CTTACAGGAGAGTCTCTACCTGTCACCAAGAGGACAGGAGATGAAGTGTTTTCTGGTTCA ACATGTAAGCATGGAGAGATTGAAGCTGTAGTGATAGCAACTGGGGTTCACTCCTTTTTC GGAAAAGCAGCACATTTAGTTGACTCCACAGAGGTTGTTGGACATTTCCAGCAGATTCTA GATCTATGCCCCGAGAAAGATGAGATTGCTGGAAGAGTGCATAACATTATTGACAAATTT GCTGAAAGGGGATTGCGGTCTCTTGGAGTTGCTTATCAGGAAGTTCCAGAAAAAACTAAA GAAAGCCCTGGAGGTCCTTGGACATTTTGTGGGTTGTTGCCCTTGTTTGATCCTCCAAGG CATGATAGTGCTGAGACTATTCGAAGAGCACTTAACCTTGGAGTCTGTGTGAAGATGATT ACAGGTGATCAGTTGGCAATTGCAAAGGAGACAGGGCGACGACTTGGGATGGGAACAAAC ATGTACCCTTCCTCTTCATTGTTGGGCCGTGACCGTGACAAAGAAGAACACGAAGCTCTT CCGGTGGATGAGTTGATTGAGAAGGCTGATGGCTTTGCTGGAGTCTTCCCTGAACACAAG TACGAAATCGTAAAAATTTTACAAGAAAAGAAGCATGTGGTTGGAATGACCGGAGATGGT GTTAACGATGCACCTGCTTTAAAGAAAGCAGACATTGGTATAGCAGTGGCAGATGCCACA GATGCTGCAAGAAGTGCTTCTGACATAGTCTTAACTGAGCCTGGCTTAAGTGTGATTGTC AGTGCTGTCCTGACCAGTAGAGCTATATTCCAAAGAATGAAGAATTATACACTTGGTTTC GTTCTTCTTGCTTTGATATGGGAATATGACTTCCCACCTTTCATGGTTCTGATTATAGCA ATACTCAATGATGGAACCATCATGACGATTTCCCAGGATCGTGTAAAGCCCTCTCCAAAG CCAGACAGTTGGAAGCTTAAAGAGATATTTGCAACTGGCATTGTCATTGGCACATATCTT GCTTTGGTAACTGTATTATTTTACTGGGTTGTAGTCGACACCGACTTCTTTGAGACCACC TTCCATGTAAGAGATTTATCCAGCAACAGTGAGGAAATTTCATCTGCTGTATATCTGCAA GTTAGCATCATTAGCCAGGCTCTCATATTTGTTACAAGAAGCCAGGGATGGTCATTTCTT GAAAGGCCTGGAACTCTCTTGATGTGCGCATTTGTGCTGGCTCAACTGGTGGCTACTTTA ATTGCTGTCTATGCAAGCATCAGCTTTGCTTATATCAGTGGCATTGGATGGGGATGGGCT GGTGTCATATGGTTGTACAGTTTGATTTTCTACATTCCCCTGGATATCATCAAATTTGCA ATTCGCTACGCCTTGACTGGAGATGCCTGGAATCTATTGTTTGATAGGAAGACGGCTTTC ACTTCTAAGAAAGATTATGGGAAGGAAGATAGGGCAGCTAAGTGGGTACTTTCTCAGAGA AGTTTACAAGGGTTGGCAGACATGGAGATCAATAAGACTGGCAAGCGATCTTCTTTGATC GCAGAACAGGCCAGGCGGCGTGCCGAAATAGCCAGGCTGGGAGAGATACACACTCTGAGA GGACATGTAGAATCTGTAGTGAGGCTCAAGAATCTGGACTTAAGTGTTATTCAATCAGCC CATACTGTCTGA
PEP MLPQASSPGHLVSSSSRPNDVHFSSVSPCERRSQNSPFIFKLPVDEKSLSLTHSSHSEVQ PTALINYSEENKDISWYPDSLQEFLHFPENVPDQNGLVDSSAGVITSEDHAEKTDWSDWD PLISFDDALDPNWELPIDVDAVDPKPKVELQKRLHEQLEERLPLEEVFEQLRTSPQGLSS EDAEARLKIFGFNKLEEKTENKFLKFLSFMWNPLSWVMEAAAIMALVLANGGGEGPDWQD FVGIIILLIINSTISFIEENNAGNAASALMARLAPKTRSALTGESLPVTKRTGDEVFSGS TCKHGEIEAVVIATGVHSFFGKAAHLVDSTEVVGHFQQILDLCPEKDEIAGRVHNIIDKF AERGLRSLGVAYQEVPEKTKESPGGPWTFCGLLPLFDPPRHDSAETIRRALNLGVCVKMI TGDQLAIAKETGRRLGMGTNMYPSSSLLGRDRDKEEHEALPVDELIEKADGFAGVFPEHK YEIVKILQEKKHVVGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIV SAVLTSRAIFQRMKNYTLGFVLLALIWEYDFPPFMVLIIAILNDGTIMTISQDRVKPSPK PDSWKLKEIFATGIVIGTYLALVTVLFYWVVVDTDFFETTFHVRDLSSNSEEISSAVYLQ VSIISQALIFVTRSQGWSFLERPGTLLMCAFVLAQLVATLIAVYASISFAYISGIGWGWA GVIWLYSLIFYIPLDIIKFAIRYALTGDAWNLLFDRKTAFTSKKDYGKEDRAAKWVLSQR SLQGLADMEINKTGKRSSLIAEQARRRAEIARLGEIHTLRGHVESVVRLKNLDLSVIQSA HTV


| Top |