Cherry SNP DataBase

Gene information

Gene Pav_sc0000843.1_g640.1.mk
Chromosome name PAV_r1.0chr3
start 1199548
end 1217360
PAV_r1.0 name Pav_sc0000843.1
start 355867
end 373679
direction +
Annotation NR PREDICTED: histone acetyltransferase HAC1
Sequence CDS ATGAATGTGCAGACACACATGTCAGGACAGATATCTGGGCAGGTGCCCAATCAGGCAGGC ACTCAGATGCCTGTGCTGTCCCAACATAATGGAAATTCCCTTCCTCCCCAAATGCAAAAC TTAGGTGGGCATGCTCGTGCTATGTCTAACATGGATCCTGAGATTCCCACATTACGTTCA ATTATGCAAGAAAAGATTCTTATTGCAAAAGGTTCTTACCTGGACGACTATATGAACATG GAAACATTGGAGAGTCGTTTGCACAATTTGATTAAGAGACCCCAAAACCAGAGCCAACAG TATCAACAGCTTGTTAATTCTTCCTCTCCTATTGGTACAATGATACCGACCCCTGGTATG TCACACAATGGGAACTCAAATATGATGGTTACTTCTTCTGTGGATGCTTCTATGAACACT ACAAGAGGAAGTACTAGCATTGCACCTACTACAGTCAACACAGGGAACCTGTTGCCTGCT GGCCCCTTACATGGTGGTTCATTCAATAGATCTGACGGTTCTATGTCTAATGGATATCAG CAATCTCCTGCCAGTTTCTCCATTGGTACTGGAGGAAACATGTCATCAATGGGTGTGCCA AGAATTACTAGCCAGATGATTCCTACTCCTGGGTTTAATAGCAGTAGTAATCAGTCTTAC ATGAATTTGGAATCTTCTAATAATGGGGGTGGGTTCTCTACTGTTGATTCTTCAATGGTA ACACAGCCACAACAGCAAAAGCAGCATATTGGTGGTCAAAATAGCCGTATACTTCATAAC GTTGGCAGCCAAATGGGCAGTGGAATAAGGTCTGGCATGCAGCAGAAACCTTATGGGTTG CCAAATGGGGCTCTAAATGGTGGGTTGGGATTGATTGGGAACAATTTACCACTGGTTAAT GAATCTGGCACTTCTGAGGGCTATATGACATCAACACCTTATGCTAACTCTTCTAAACCA TCACAACAACACTTTGATCAACATCAGCGGCCTATAATGCAGGGTGATAGCTATGGAATG AGTAATGCTGATTCGTTTGGGCCTGGAAACTACTATGGTGCTGCAACGCCTGTTGGGTCA ATGTTGAATGCTCAGAATTTGAATTCACAAATGCAACAAATATTGCAGCCTCACCAATTG GTTGCAGAGTCTCAAAATGATTTCAGATCTCTCTCTGTTGGAGCTCAATCAGAACCAGTA CTGCAAGGTCAATGGCATCCTCAATCGCAAGATGGGAGTCACAGACAGGCCAACATGTCC CATGAGCAGCATGTCCATGAAGATTTCCGTCAGAGGATATCTGGGCAAGATGAAGCTCAG TGTAATAATTCATCTTCAGAAGGACCTAATGTTGTTCAAAATATGGGGTCTAGAAGCATA TCTCGTCCCCTCAATTCATCGAGTGCTGCTTCTAGATCTGCTTATGTCAATCGAGATAAA TGGTTTCTAAATCAACAGAGATGGCTTTTGTTAATGCTCCATGCTCGTTGTTGTACAGCC CCTGAAGGGAAATGTCGAGAAGCTCGTTGTGTAATTGTTCAGAAATTGGTGCAACACATG AAGTCCTGCGAATCTTCTCAATGCACATATAGTCGTTGTCGTATTTCAAAGTTATTGGTT CTACATAGCCAGACTTGCAAAAGCAAAAAAGCTTGCCCCGTTTGTGGCCCTGTCTTGAAT TATCTGAATAAGGAAAAGAACCGTCGAGTTTCTGATTCCGGTTTGCAGAACTCAATAAAT GGATCCAGTAAAATCTATGATAGTGGGGACACTTCTGCTAGATTGGTTTTAAAGACGGCT CCGGTTGTTGAAACTTCTGAGGATCGGCAACCTTCTATGAAACGCATGAAAGTAGAGCAG TCCTCTCAATCTGTTGTTCCTGATAGTGTTAATGTTAGTTCTGCAGTAAAAGTTTCTGCC ATTAGCGAACCCCATGTATCTGAGGATATACAGATTCAGGATTACAAACATAGTGAGATT TCTATGCCAGTTAAGTCTGAGTTTGCAGAAGTGAAAATGGAAATTCCTGTAAGTTCTGGG CAAGGGAGTCTTGATGAGATGAAGGATAGTGTTGATGATAACTGCAATTCAAGGCATGAT GGTGAACCTGTCTCATATAATGATCCTGCTGGTTTAGCGAGACAAGAGAACATCAAACTT GAGAAAGAAACTGATCCAGCTAAACAAGAAAATGCTGCTCAGCCTGTGGAAAATGCAGCT GCAACCAAGTCTGGGAAGCCTAAAATAAAGGGGGTGTCAATGACTGAACTTTTCACTCCA GAGCAAAGCAAAGCGAAGGCAGAGAAAAATCAAGCAATGGAGCATTCAATGAGTGAGAAC TCCTGTCAGTTGTGTGCAGTTGAGAAGCTTACCTTTGAGCCACCACCGATATATTGCACA CCTTGTGGTGCTCGTATCAAGCGCAACGCGATGTATTATACTATGGGGGCTGGTGACACA AGACATTATTTCTGTATTCCATGCCATAACGAGGCTCGTGGAGACACTATAGTCGTTGAT GGGACTGCGATTCCAAAGGCAAGGCTGGAGAAGAAGAAAAATGATGAGGAGACTGAAGAA TGGTGGGTCCAATGTGACAAATGCGAAGCTTGGCAACACCAGATTTGTGCTTTGTTTAAT GGCCGAAGAAATGAGGGTGGGCAAGCTGAATACACTTGCCCTTATTGCTATATACAAGAG GTTGAGAGAGGAGAGCGTAAGCCTTTACCACAGAGTGCTGTTCTGGGGGCCAAAGATTTA CCGAGGACAATACTGAGCGACCATATAGAGCAACGGTTATTTAAGAAACTGAAGGTGGAA AGACAAGAGAGGGCGAAGCAGCAAGGAAAAAGTTATGATGAGGTTCCTGGGGCAGAATCA CTTGTAATTAGAGTTGTTTCATCAGTTGACAAAAAATTGGAAGTAAAGCAGCGGTTTCTT GAAATTTTTCAGGAAGAAAATTATCCAACAGAGTTCCCATATAAATCTAAGGTTGTATTA TTGTTTCAGAAAATTGAAGGTGTAGAAGTATGCCTATTCGGCATGTATGTTCAAGAATTT GGAGCTGAATGTCAATTTCCAAATCAGCGCCGTGTATATCTATCGTATTTGGATTCTGTT AAGTATTTCAGGCCCGAAGTTAAAGCGGTGACGGGAGAAGCTCTCCGCACATTTGTTTAC CATGAAATTCTCATTGGATATCTTGAATATTGCAAGAAACGAGGGTTTACAAGCTGCTAC ATATGGGCTTGTCCTCCTTTGAAGGGCGAAGATTATATTTTATATTGTCATCCGGAAATT CAGAAAACACCAAAATCAGATAAGCTTCGTGAATGGTATTTGGCAATGCTCAGGAAAGCT GCCAAGGAAAGCATTGTTGTTGAACTCACTAATCTATATGATCATTTCTTTGTTACTACT GCTGAATGCAAGGCTAAAGTCACTGCAGCTAGGCTGCCTTATTTTGATGGTGACTACTGG CCTGGTGCAGCTGAGGATCTGATTTATCAGATGCGTCAAGAAGAGGATGGTAGAAAACAG AACAAGAAAGGAACAACCAAAAAGACTATAACAAAAAGGGCTTTAAAAGCATCTGGTCAG ACTGATCTTTCTGGAAACCGTTGGTCCTGCACCCAATGCAAAAATTTTCAGCTTTGTGAT AAGTGTTATGAAGCAGAGCAAAAGCGGGAAGAAAGAGACAGGCACCCTTCCAATCAGAGG GAAAAACATGAATTGCGTCCTGTATGTGAATTGTCCTTCCCTTCAGTTATCATGGCTCTG CGATTTGACATTACTGACGTACCTGCTGATACAAAGGACAAAGACGAGATTCTTGAGAGT GAATTCTTTGACACCAGACAGGCATTTCTCAGTCTTTGTCAAGGGAATCATTATCAGTAT GATACTCTACGGCGGGCTAAACATTCCTCTATGATGGTCCTTTACCATCTTCATAACCCA ACTGCTCCTGCATTTGTGACAACATGCAATATATGTCATCTCGACATTGAAACAGGTCAA GGTTGGCGTTGCGAAGTTTGCCCTGAATATGATGTATGCAACAATTGTTATCAGAAGGAA GGAGGTGTAGATCATCATCATAAATTGACAAATCATCCATCCATCGCTGATCGTGATGCA CAAAACAAAGAAGCTAGGCAAATCCGAGTTTTACAGCTTAGGAAAATGCTTGATCTTCTG GTGCACGCATCGCAATGTCGTTCAGCACAATGTCAGTACCCTAATTGTCGTAAGGTGAAG GGGCTTTTCCGCCATGGAATTCAATGCAAAGTCCGGGCATCTGGAGGATGTGTTCTCTGT AAGAAAATGTGGTATCTCCTTCAACTTCATGCTCGAGCTTGCAAAGAATCTGAGTGCCAT GTGCCACGCTGCAGAGATTTAAAGGAACATTTGAGGAGGCTGCAGCAGCAGTCTGATTCA CGAAGAAGAGCTGCTGTTATGGAGATGATGAGACAAAGAGCTGCCGAGCTACACAGCAAT ACTGGGGCATCTGGAGCTCCCTCTGAAAGCAACAATGGCGGCAGTAGCAGCAATAAAACC AAAACCAAGAACAAAACCATTGATCCTCCTCCGTCTGCTTCTTCTTCTGGTAACGAGAAA ATTGATACCAGTAATAAGATTCAAGAAGAGCAAGAGCAGAAGCAGAAGCAGCAGCGGAGA TTGGACCTGGAAGATGTGAACCCAGTTGGGCTCGGTCGAAGATCGCGCCAACTGTTTGAT GAAGTGTGGCGCAAGTTCTCTGGACTCGGGCAGATCTCGAGAACCAGTCGTGCCGATGAA AGAGACGCGCTTGACGCTCTTCTCATCAGGGAAGGACCCATGTGCGAGTTCGTCATTCCC GGCGCCCAAAACACCACCGTTTTGGTCGTCGGAGCCACTTCAAGCATTGGCCGCATAGTG GTCCGCAAGCTCATGCTCAGAGGCTACACTGTTAAGGCTGATCAGGAAGTGGTGGATATG TTGCCGAGATCGGTGGAGATTGTGACTGGGGATGTGGGTGATCCTGCTACGCTATACGAC GCCGTACAAGGCTGTAACAAGATTATCTATTGTGCTACTGCACGCTCTACTATCAGCGGG GACCTCTACAGGGTTGATAACAGAGGGGGGACTTACTTCCAGGATGTGGTTTCTTCCAAG TATGATGGAGGAATGGATGCTAAGTTTGAGTTCACTTTTACGGGAGATGCTGTTTTCTCA GGATATGTTTTCACCAGGGGAGGGTATGTTGACCTGTCGAAGAAACTTTCACTTCCTTTG GGTCGTACTCTTGACAGGTATGAAGGTCTAGTTCTTTCTGTTGGTGGGAATGGAAGGTCT TATATATTAATTCTTGAAGCTGGTCCATTAGCGGATACATCTCAAAGTAAATTATACTTT TCTAGATTCAGCACAAAAGCAGGATTCTGTAGGGTCAGAGTACCATTTTCATCATTCCGC CCCGTGAAACCAGATGATCCACCATTAGACCCATTCCTAGTACATACATTAACCATACGT TTTGAGCCCAGAAGACAGAAAGCTGTTGAATCACGTACAGGAGTGAAGCAAGACCCAAGA AGCTTTAAGCTTATTCTGGAATACATAAAAGCTTTGCCAACTGGACAAGAAACGGACTTC ATTTTAGTTTCATGTACGGGATCAGGAATAGAACCAACTAGAAGGGAGCAGGTTCTTAAA GCCAAGAGGGCTGGAGAAGAGTCATTGCGAAAATCAGGGCTTGGATACACAATCATTCGT CCTGGTCCCCTAAAGGAAGAACCAGGTGGACAACGTGCTCTCATATTTGATCAAGGAAAC AGGATTTCTCAGGGGATCAGCTGTGCTGATGTAGCTGACATCTGTGTGAAGGCATTGCAT GATTCAACTGCAAGGAACAAAAGTTTTGATGTATGCTATGAATACGTTGCCGATCAAGGG AAGGAACTTTATGAGCTGGTAGCACATTTGCCTGACAAAGCCAATAACTATCTGACACCG GCACTGTCGGTTCTAGAGAAGAATACCTGA
PEP MNVQTHMSGQISGQVPNQAGTQMPVLSQHNGNSLPPQMQNLGGHARAMSNMDPEIPTLRS IMQEKILIAKGSYLDDYMNMETLESRLHNLIKRPQNQSQQYQQLVNSSSPIGTMIPTPGM SHNGNSNMMVTSSVDASMNTTRGSTSIAPTTVNTGNLLPAGPLHGGSFNRSDGSMSNGYQ QSPASFSIGTGGNMSSMGVPRITSQMIPTPGFNSSSNQSYMNLESSNNGGGFSTVDSSMV TQPQQQKQHIGGQNSRILHNVGSQMGSGIRSGMQQKPYGLPNGALNGGLGLIGNNLPLVN ESGTSEGYMTSTPYANSSKPSQQHFDQHQRPIMQGDSYGMSNADSFGPGNYYGAATPVGS MLNAQNLNSQMQQILQPHQLVAESQNDFRSLSVGAQSEPVLQGQWHPQSQDGSHRQANMS HEQHVHEDFRQRISGQDEAQCNNSSSEGPNVVQNMGSRSISRPLNSSSAASRSAYVNRDK WFLNQQRWLLLMLHARCCTAPEGKCREARCVIVQKLVQHMKSCESSQCTYSRCRISKLLV LHSQTCKSKKACPVCGPVLNYLNKEKNRRVSDSGLQNSINGSSKIYDSGDTSARLVLKTA PVVETSEDRQPSMKRMKVEQSSQSVVPDSVNVSSAVKVSAISEPHVSEDIQIQDYKHSEI SMPVKSEFAEVKMEIPVSSGQGSLDEMKDSVDDNCNSRHDGEPVSYNDPAGLARQENIKL EKETDPAKQENAAQPVENAAATKSGKPKIKGVSMTELFTPEQSKAKAEKNQAMEHSMSEN SCQLCAVEKLTFEPPPIYCTPCGARIKRNAMYYTMGAGDTRHYFCIPCHNEARGDTIVVD GTAIPKARLEKKKNDEETEEWWVQCDKCEAWQHQICALFNGRRNEGGQAEYTCPYCYIQE VERGERKPLPQSAVLGAKDLPRTILSDHIEQRLFKKLKVERQERAKQQGKSYDEVPGAES LVIRVVSSVDKKLEVKQRFLEIFQEENYPTEFPYKSKVVLLFQKIEGVEVCLFGMYVQEF GAECQFPNQRRVYLSYLDSVKYFRPEVKAVTGEALRTFVYHEILIGYLEYCKKRGFTSCY IWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLAMLRKAAKESIVVELTNLYDHFFVTT AECKAKVTAARLPYFDGDYWPGAAEDLIYQMRQEEDGRKQNKKGTTKKTITKRALKASGQ TDLSGNRWSCTQCKNFQLCDKCYEAEQKREERDRHPSNQREKHELRPVCELSFPSVIMAL RFDITDVPADTKDKDEILESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYHLHNP TAPAFVTTCNICHLDIETGQGWRCEVCPEYDVCNNCYQKEGGVDHHHKLTNHPSIADRDA QNKEARQIRVLQLRKMLDLLVHASQCRSAQCQYPNCRKVKGLFRHGIQCKVRASGGCVLC KKMWYLLQLHARACKESECHVPRCRDLKEHLRRLQQQSDSRRRAAVMEMMRQRAAELHSN TGASGAPSESNNGGSSSNKTKTKNKTIDPPPSASSSGNEKIDTSNKIQEEQEQKQKQQRR LDLEDVNPVGLGRRSRQLFDEVWRKFSGLGQISRTSRADERDALDALLIREGPMCEFVIP GAQNTTVLVVGATSSIGRIVVRKLMLRGYTVKADQEVVDMLPRSVEIVTGDVGDPATLYD AVQGCNKIIYCATARSTISGDLYRVDNRGGTYFQDVVSSKYDGGMDAKFEFTFTGDAVFS GYVFTRGGYVDLSKKLSLPLGRTLDRYEGLVLSVGGNGRSYILILEAGPLADTSQSKLYF SRFSTKAGFCRVRVPFSSFRPVKPDDPPLDPFLVHTLTIRFEPRRQKAVESRTGVKQDPR SFKLILEYIKALPTGQETDFILVSCTGSGIEPTRREQVLKAKRAGEESLRKSGLGYTIIR PGPLKEEPGGQRALIFDQGNRISQGISCADVADICVKALHDSTARNKSFDVCYEYVADQG KELYELVAHLPDKANNYLTPALSVLEKNT


| Top |