Cherry SNP DataBase

Gene information

Gene Pav_sc0000845.1_g230.1.mk
Chromosome name PAV_r1.0chr8
start 14460318
end 14463510
PAV_r1.0 name Pav_sc0000845.1
start 105661
end 108853
direction -
Annotation NR PREDICTED: PI-PLC X-box domain-containing protein DDB_G0293730-like
Sequence CDS ATGGCCTATGGAAGAAGCCAAACCAGCTCTTTCCTAGAAGGGTTCTCTCTAAGTCCCCTG CCATATCCAGTTCTGCTAATTCTTGCAGTAATCTCAATCTTTCTTGGCATATCCTGGTAC TCATCCCTTGAGTCAGCTGCGGAAGAAGCTGAAACGCAATTCAATTGGTTGCTTTTTGTT ACACCAATAGCACTTCTGCTTCTTATAGAACGCCGTAAGGCGATCTCAACGGAGAGGAAA TCGATGCGTGATCTTCATCAAAGCTGTGGTGAGGACTTTCCAGCTTGTGCCCTTAGGCCT ACAGATAGAAAAAATTGGATGGCAGGCCTCAACCCTGAGAAGCTTCACATACACAATATT TTATGGCCAGGAACACATGACTCTGCAACCAACAAGATTGGATTTCCATGCATAACTAGG CCTTTTGCACAATGCCAAACTCTGTCCATCTACCAACAGCTTGTCATAGGCACCAGAGTG TTTGACATTCGGGTTCAAAAGGATCGTCGCGTCTGCCATGGAATTCTTGTCACATACAGC ATTGATATTGTGATCAGAGACATCAAGAAGTTTCTATCTGAAACAAAGTCAGAGATCATA CTCCTTGAAATCAGGACGGAACATGGTCATGATGACCCTCCTGATTTTGAGCAGTATTTG GTGCATCAATTTGGGGAGGTTCTCATCCACCAGGATGACAATGTGTTCAACAAGACCATT GCAGAATTGTTTCCGAAGCGAATAATATGCGTGTGGAAGCCAAGGAATTCACCTCAGCCT AAGGCAGGGGGCCTTCTATGGAGTTCTGAGCACTTGAAGGATGACTGGATCAACACGGAT TTGCCATCGACAAAATTCGAAAGCAACTTGAAGTATTTGAGTGAGCAGCCTCCAATTTCA ACAAGGACATTCTTTTACAGGGTGGAGAACACAGTGACACCTCAGCCTGATTACCCTATT GTGTGTGTGAAACCGGTGACCGGTCGGATTCATGAGTATGCAAGGCTGTTTATAACTCAG TGCTTCTCTAGAGGTATTGAAGATAGGTTGCAAATCTTCTCTACTGATTTTATAGATGAG GATTTTGTTGATGCATGTGTAGCTGTTACATATTCAAGAATTGAACGGAAAGCCTGA
PEP MAYGRSQTSSFLEGFSLSPLPYPVLLILAVISIFLGISWYSSLESAAEEAETQFNWLLFV TPIALLLLIERRKAISTERKSMRDLHQSCGEDFPACALRPTDRKNWMAGLNPEKLHIHNI LWPGTHDSATNKIGFPCITRPFAQCQTLSIYQQLVIGTRVFDIRVQKDRRVCHGILVTYS IDIVIRDIKKFLSETKSEIILLEIRTEHGHDDPPDFEQYLVHQFGEVLIHQDDNVFNKTI AELFPKRIICVWKPRNSPQPKAGGLLWSSEHLKDDWINTDLPSTKFESNLKYLSEQPPIS TRTFFYRVENTVTPQPDYPIVCVKPVTGRIHEYARLFITQCFSRGIEDRLQIFSTDFIDE DFVDACVAVTYSRIERKA


| Top |