Cherry SNP DataBase

Gene information

Gene Pav_sc0000848.1_g190.1.mk
Chromosome name PAV_r1.0chr8
start 19771168
end 19773573
PAV_r1.0 name Pav_sc0000848.1
start 111496
end 113901
direction +
Annotation NR PREDICTED: rho GTPase-activating protein 2-like
Sequence CDS ATGACAGGGCTTGTAATGGTGACAAGGGGAGGTGGGTGCGGTGGTGGTAATGGGAAAGGA ACTAAAGGAACTAACAAGAGCTCAGAGGAAGAGCAAAACCAGATTTCTCTGGCAGCCCTT CTCTTAGCTGCTGTAAGGAAATCCATGGTGGCCTGCCGTGTTGAACGAGGTGAAGAAGTC ATCTCTACCGTCCACAACATGGAGATCGGGTGGCCCACAAATGTCCAACACGTTACCCAT GTCACCTTTGATCGCTTCAATGGGTTTCTGGGTCTTCCTGTTGAGTTCGAGGTTGAGGTC CCTGGTCGAGTTCCCAGTGCTAGTGCAAGTGTGTTTGGCGTCTCAGCGGAGTCAATGCAG CTGTCTTTTGATTCAAAAGGGAACAGTGTCCCTATCATTCTCTTGCTACTGCAGGAGCGA TTATACTCACAAGAAGGACTGAAGGCAGAAGGAATATTCCGTATCAACCCAGAGAACAGC CATGAGGAGCTTGTGAGAAGCCAATTGAATAGGGGGATTGTACCTGATGACATTGATGTC CATTGTCTGGCAGGCCTAATTAAAGCCTGGTTTCGAGAACTTCCTTCCGGAGTGCTAGAT GGACTATCCCCTGAACAAGTTCTTCAATGTAACACAGAAGAGGAATCTGTTGAGCTTGTG AAGCAGTTAAAACCAACTGAGACCGCGTTACTCAATTGGGCTATAAATCTGATGGCTGAT GTTGTTGAGGAAGAAGAATTCAACAAAATGAATGCAAGAAATATCGCTATGGTTTTTGCT CCAAACATGACTCAGATGTCTGATCCTCTGACGGCTTTGATGCATGCGGTTCAAGTAATG AATTTGCTTAAGACCCTGATTATGAGAACACTAAGAGAACGGGAAGAGAATGATGAAACT GGTGGATATTCACCAATGTCATCTTGTTCATCTGATCATCAAACAGATGAAGACTTTGAT AGTCAGCAGGAAATGGATACCAGATCTGAATTGAGGGGACCGGCATCGGACTGTGATGAA AATGGCCACTCCAGCTGCAGCAGTGAAGATGAAGATGAAGATGAAGTCCGGTCGCTAAGC GAGATAGAAGCATGCTTCTTAAGACACTTAGGTGAGAATAAAGCTGTCACAAATAGCTTG GATCAATCAACAGGCGAGTTGCATGGGGAGTCTCTAAGTCCTCAAAGTTGCCTGAGTACA AGTGATGGGGAAGAGTCTGGGAAACGTATAAAGAGCTCTTCATCAGTATCATGTTCAAAC ATGAATGAAATGGAGATGGTGGACAGATAA
PEP MTGLVMVTRGGGCGGGNGKGTKGTNKSSEEEQNQISLAALLLAAVRKSMVACRVERGEEV ISTVHNMEIGWPTNVQHVTHVTFDRFNGFLGLPVEFEVEVPGRVPSASASVFGVSAESMQ LSFDSKGNSVPIILLLLQERLYSQEGLKAEGIFRINPENSHEELVRSQLNRGIVPDDIDV HCLAGLIKAWFRELPSGVLDGLSPEQVLQCNTEEESVELVKQLKPTETALLNWAINLMAD VVEEEEFNKMNARNIAMVFAPNMTQMSDPLTALMHAVQVMNLLKTLIMRTLREREENDET GGYSPMSSCSSDHQTDEDFDSQQEMDTRSELRGPASDCDENGHSSCSSEDEDEDEVRSLS EIEACFLRHLGENKAVTNSLDQSTGELHGESLSPQSCLSTSDGEESGKRIKSSSSVSCSN MNEMEMVDR


| Top |