Cherry SNP DataBase

Gene information

Gene Pav_sc0000848.1_g300.1.mk
Chromosome name PAV_r1.0chr8
start 19828599
end 19836158
PAV_r1.0 name Pav_sc0000848.1
start 168927
end 176486
direction -
Annotation NR auxin response factor 11
Sequence CDS ATGGCGCCGAGGACGACTGCCGGTGTAGAAGGCTTGGGGCCCACCACCGTCAATATTGCC GAGAGAGAAAGCAGCGGATGCAGCGTTGGTTCAGCCTTCCCTGCTGATGCTGCTGCTGCT GCTGCTAACATGAATAAACGAGGTGGACGACCTGAACCAGTCGAGACATATGCAAACGAA GATGGCAAAATGGAAATGCCAATTTATAATTTGCCTTCCAAGATCCTCTGCAATGTTGTC TGTGTTCTGCTAAAGGCTGAAGTTCACACAGATGAAGTGTTTGCTCAAATCACCTTGATT CCTCTGACTAAGCAAGAACAGCTAAGTTTAGATGAAGAAAATAATCAACCCGTGCCTCAG AGCACCAGTACACGCTCCTTTAGCAAGACACTCACCCCATCTGACACAAGCACTCATGGT GGATTCTCTGTTCCGAAACGACAAGCTGATGAGTGCCTTCCACCCCTGGTTGGTTTAGAA GCCAGTTCCTTCACAAGTTATAGATGTTTTTGCAGGACATGTCTCAGCAACCACCAGTAC AAGAACTCGTCGCAAGGGACTTGCAGGGATTTGAGTGGCACTTTCGCCATATATTTCGCG TTATCTAATGATTGTACTTCTTGCTTCAGAGGAGAAAATGGAGAGTTGCGTGTTGGGATA CGCCGTGCGAACAAAAAACAGGACAATGCATCAACTGCTCTCATTTCAGGCCACAGCATG CAACATGGCATACTTGCCAGCGCATTCCATGCCAACTCTACTGGTACCTTGTTTACTGTG TACTATCGTCCATGGACCAGTCCTGCTGCATTTATAATTCCTTATGATCAATACATGAAA TCAGCAAAAAATGACTATTCTATTGGTATGAGATTCAGAATGTGTTTTGAAGGTGATGAA TGTGCAGAGAAAAGATTGGCGGGTACTATAATAGATATTGAAGATAATGATTGTATCAGG TGGCCCAGTTCAGAATGGAGGTGTCTGAAGGTCCAATGGGATGCCTCATCAGATACAAAC TTGCATCCTGAAAGGCTTTCTCCTTGGAATATCATGCCTCTCCAACCTAATAAGAGAGCA CATGTTCCTGATCTGATATCACCTGGGTTTCCTAACTTGGCCACGAATGGCTTATTGCCA ATTCCAGTTGAGTATACACCTCCAAGACAAAAAAAGGTCTTTCAAGGTCAAGAAATTAGT GACCCACCTGCTCATGAACCGGGTACACAAAAACCACCATTACTACCGCAGTTTATTCCA CCATCAAATCCTGACTGGAACCATACACAATTGGGATTGGAAAACAATCCATTGCATGAC CCACTTTATCAATGTCCTGGCAGTGCAATAGCTCCAAGTCTCACTAACCAATGGCCACCG ATATTTAATTTTGGAGTCTTGGACAGTGTCGCGTTTAGAAGAAGCATGTCAGTTCCAAAT ATCAAATCCTCTGGGTCCCAGGACTCGAGGGCCTTCAAACCAAGGAGTGAGATTGAAGCG CCACTTGTCCAACCAAATAGCCGTGGTACAACCATGCTGTTTGGAGTCAATATAGTTACT AGTCACCCGGAGCTCCCTTCACCACAAGTTGTCACTTCTAGTGAACTTTTTAGTCCTTGT TCTATTACTCCAATATCTCAGTCGAGTGTTTCTGAAACTATCCAGATTTCAGAGACATCT AAGAGTGTTTCTGGTGTTCTTTCTGCGAAACAATGCAATAAATGTTGCTCTGTCACTAAC AGGAGCTGCATAAAGGTGCTCAAATATGGAGCTCCTGTTGGAAGGTCAGTGGACCTCACA CGCTTTGATGGGTATGGTGAACTCATTTCTGAGCTTGACCAGATGTTCGATTTCAAAGGA AGCTTGATCGATGGAAGCAGTGGGTGGCAGGTAACCTACATGGATGATGAAGGAGACATG ATGCTGATAGGAGATTACCTGTGGCAGTTAAGAACTAGAACTCATACTGTGACTCATAGT TTGCCATTTCTGATGCACAAGCTCCCTTCATATATTTCCCGCCACCAAAACATTTTCTCT CGTCAAAGAAAATCTAGCAGAGAAAAGAAAGTAACCATGAAATCTTTGTATCCAACTAGA CCAATTACAGCCGTTCCAAAGTATAATTCTACCTCTTACACCAAAATTTCTGCTATCACC AATGTTGCTACGCCGACGCTCAATTTCTGGGTTTCATCACCACATCCAATTCGCTCACCG AATGATTTTCCCAAGCCACACCCACACACTGCTCTAAGATCTCAGTCTTCTTCAAACCCA CAAAGCAACGAGCAAGAGAACGATGAAGTGGAAGAAGAAGACGACCCAGATGCCCAAGTC CAAGACCTTGTGGTCCCAGAGCATTGGTTGGTCCCTTCCAAGGCCTTGGAGGAATCAGAG TGGCTTAGGGTTACTTTGCATAAGTGGTTGGATGATGAGTATTGCCCAGAAGCCACCAAT GTTGAAATCAGCAAGATTGCTGCTCAATCATACTACAAATCTTTGCTGGGAAAACAGACT GACTTGGGTGAGATTTTGCTGAAGATGGCCATAGAATTGGAATCTATTTCCTACCAGGAA AGCTTCCATGGGGCATTCTCATCCGCCAACGCAGCAGTGAATTTGATTGCCCAACGGATA GAGCAGTCCTGA
PEP MAPRTTAGVEGLGPTTVNIAERESSGCSVGSAFPADAAAAAANMNKRGGRPEPVETYANE DGKMEMPIYNLPSKILCNVVCVLLKAEVHTDEVFAQITLIPLTKQEQLSLDEENNQPVPQ STSTRSFSKTLTPSDTSTHGGFSVPKRQADECLPPLVGLEASSFTSYRCFCRTCLSNHQY KNSSQGTCRDLSGTFAIYFALSNDCTSCFRGENGELRVGIRRANKKQDNASTALISGHSM QHGILASAFHANSTGTLFTVYYRPWTSPAAFIIPYDQYMKSAKNDYSIGMRFRMCFEGDE CAEKRLAGTIIDIEDNDCIRWPSSEWRCLKVQWDASSDTNLHPERLSPWNIMPLQPNKRA HVPDLISPGFPNLATNGLLPIPVEYTPPRQKKVFQGQEISDPPAHEPGTQKPPLLPQFIP PSNPDWNHTQLGLENNPLHDPLYQCPGSAIAPSLTNQWPPIFNFGVLDSVAFRRSMSVPN IKSSGSQDSRAFKPRSEIEAPLVQPNSRGTTMLFGVNIVTSHPELPSPQVVTSSELFSPC SITPISQSSVSETIQISETSKSVSGVLSAKQCNKCCSVTNRSCIKVLKYGAPVGRSVDLT RFDGYGELISELDQMFDFKGSLIDGSSGWQVTYMDDEGDMMLIGDYLWQLRTRTHTVTHS LPFLMHKLPSYISRHQNIFSRQRKSSREKKVTMKSLYPTRPITAVPKYNSTSYTKISAIT NVATPTLNFWVSSPHPIRSPNDFPKPHPHTALRSQSSSNPQSNEQENDEVEEEDDPDAQV QDLVVPEHWLVPSKALEESEWLRVTLHKWLDDEYCPEATNVEISKIAAQSYYKSLLGKQT DLGEILLKMAIELESISYQESFHGAFSSANAAVNLIAQRIEQS


| Top |