Cherry SNP DataBase

Gene information

Gene Pav_sc0000848.1_g950.1.mk
Chromosome name PAV_r1.0chr8
start 20122109
end 20131663
PAV_r1.0 name Pav_sc0000848.1
start 462437
end 471991
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103934131 isoform X3
Sequence CDS ATGGTTGAAACCAGACGCAGCTCTTCTTCCAAACGTGCCCTATCTGCCTCCCCTCCTCCC AACCCCAAACGTTCCAAGGCGTCTGACGCTTCGTCGTCCAACAACGGAGTTAGGAGCGGG CCGCCGGCGGAGCCCTTGGGTCCGATAAAGGAATCTGGGTCCCAACCTCCAGAAATTGAG CTCCGATCCTCTGATCCGCCAAGCACTGATTCGTTGAAGGCTGTTAACGGCTCTGATGCC ACCGTTTTCGAGAGATCTCCCGATGTCGTGGCCGAAGGCGAGGCCTTGGTTTCGCCGCAG CCCTTGGGGGAGACTGCAGTCCGTGCGGGGTTGAAGCGGGCTAAGAAGCTTCCAAAGAAG ACTACAAAATCAAATTCGAAATCAGCTTGGGGAATGCTTATTTCCCAGTGCTCTAAGCGT GAAGGTTCATCCATTGCAGAATTAGAAATTACAGGGGGTAAAGGTGATGTTCAAGTAAAT GAGAAGATTTATCAAAAAGATTCGAAGGTGGTTCTTAGTGGAGGGGATGAGGTTGTATTC ACTGCTCAGGGCATTCCTTCAATTAGCATTTTAGAAACTCAGAGTACTCCAGTTAATGGG ATACATATTGAGGCAAGATCAGGGGACCCCTCTGCTGTTGATGGGGCATCAATATTAGCG TCGATGTCAAATGGGCCAAATGACTTGTCGCCCCTTCCAGAACCTGCTAAAGCTGGTGAC AATCTGCAACAAGATGCAGAGATGCCTTCTCTTGCTTCTGGCTGTGGAGGGTCAGATGAT CGTACTGCAGACATTGAGATGAAGGATACAACTAACACTAATGATCAAGTTTCAGGTGAT AAAGATATTGTTCAGTACCCTGACACTGCCGATGAAAACCCCAATGTTGATAGCCTTGCA TTGGATATGGATACTGAAACTGGAAAAGTCCCTGGGGAAGCTTATCAACTAAGACCACTT TTCCGAATGTTTGGCGGTTCTTCTAGTACAAACTTTGACTTAAGTGGCAGCATTTCCAAG ATACTTGATGAGCAAAGGGAAATCAGAGAACTTCTCCACGATTTTGATCCTCCAATTTTG ATATCAACTAGGCGACAAGCATTTAAAGAGAAACTACAACAAGGAATTCTAAATCCTGAT GATATTGAAGTCTCATTTGAAAGCTCTGAGATATATCAGGAAACCTTGGCAAAGGCACTT GCGAAACATTGTGGTGCTAGATTGCTAATTGTTGATTCTCTTCTCCTGCCTGGTGCACCA GTGCCCAAGGAAGCTGATTCTGTTAAAGAAGTATCAAGGCCTGACAGAGTTTCCGTGTTT GCTAAACGAGCAGCTCATGCTGCCGGATTAAAGCATAAGAAACCAACCTCTAGTGTTGAG GCTGAAATTACTGGTGGATCCACTGTGAGTTCTCAGGCTCCACCAAAGCAGGAGACTTCT ACTGCATCTTCCAGAGGCGTGATAAGGGGACCATCATATGGTTGTAGAGGCAAAGTTGTT CTTGCTTTTGAAGACAATGGGTCCTCAAAAATTGGGGTTAGATTTGATAAATCGATACCA GATGGCAATGATCTTGGTGGTCTTTGTGAAGAAGATCATGGCTTTTTTTGTTCTGCTAGT CATTTACTTCACTTGGATGTTTCTGGAGGTGATGACATTGACAAGCTTGCTATTAGTGAA CTTCTAGAGGTGGCATCCAATGAGAGTAAAAGTCTTCCTTTGATATTGTTTGTGAAAGAG ATAGAAAAGGCTATGGTAGGTAACTCAGATGCATATACTGTCTTAAAGAGTAAGCTTGAA AACTTGCCAGAGAATGTTGTTGTAATCGGCTCTCATACCCAGTTGGACAATCGTAAAGAG AAGTCTCATCCTGGTGGTCTTTTGTTTACAAAGTTTGGTTTTAACCAAACCGCTTTGCTT GATCTTGCTTTTCCGGATAACCTTGGTAGGCTGCATGATAGGAGCAAAGAAACTCCTAAA ACTATGAAGCAACTCACTCGGATTTTCCCCAACAAGGTGACGATACAGCTGCCTCAGGAC GAAGCTTTACTTTCGGACTGGAAGCAGCAGTTGGAACGTGATGTTGAAACTTTGAAAGCA CAGTCAAATATTGTTAGCATTCGCTTAGATGTGGTTACAGGAAACGAATTTGAAAAAAAA CTTCTTGCTGATGTAATTCCACCGAGTGATATTGGGGTTACTTTTGATGACATTGGGGCC TTGGAAAATGTTAAGGACACACTAAAGGAGTTGGTGATGCTTCCTCTTCAGAGGCCCGAA TTGTTTAGCAAAGGACAGCTGACTAAGCCTTGCAAAGGAATCTTGCTGTTTGGTCCTCCG GGTACTGGAAAGACAATGCTCGCAAAGGCTGTTGCAACTGAAGCTGGTGCAAACTTTATT AACATATCAATGTCAAGTATTACTTCAAAGTGGTTTGGGGAAGGAGAGAAGTATGTTAAA GCAGTGTTCTCTTTAGCTAGTAAAATTGCTCCTAGTGTTGTTTTTGTTGATGAGGTTGAC AGCATGTTAGGAAGGCGTGAAAACCCTGGGGAACATGAGGCTATGCGTAAAATGAAAAAT GAGTTCATGGTGAACTGGGATGGTCTGCGTACAAAGGATAAAGAACGTGTATTGGTTCTT GCTGCTACTAATAGGCCTTTTGATCTTGATGAGGCCGTTATTAGGAGGCTTCCAAGGAGA TTGATGGTGAACTTGCCAGATGCCCCAAACAGAGAGAAAATACTGAGAGTCATACTAGCC AAAGAAGATTTTGAACCTGATGTTGATTTGGAAGCAGTATCAAGTATGACGGATGGGTAT TCTGGAAGTGACCTAAAGAACCTGTGTGTTACTGCAGCTCACCGCCCCATTCGAGAAATT TTAGAGAGAGAAAAAAAGGAGAGAAGTTTAGCTGTGGTGGAGAACAGACCTCAACCTGAA TTGTATTGTAGTTCCGACATCCGTCCTTTGAAGCTGGAGGATTTTAAACATGCGCATGAG CAGTCAACTGACTGGCCCTTTCTCTTTGCTATTAGGCCTTTTGCCTGCACATACGACTGA
PEP MVETRRSSSSKRALSASPPPNPKRSKASDASSSNNGVRSGPPAEPLGPIKESGSQPPEIE LRSSDPPSTDSLKAVNGSDATVFERSPDVVAEGEALVSPQPLGETAVRAGLKRAKKLPKK TTKSNSKSAWGMLISQCSKREGSSIAELEITGGKGDVQVNEKIYQKDSKVVLSGGDEVVF TAQGIPSISILETQSTPVNGIHIEARSGDPSAVDGASILASMSNGPNDLSPLPEPAKAGD NLQQDAEMPSLASGCGGSDDRTADIEMKDTTNTNDQVSGDKDIVQYPDTADENPNVDSLA LDMDTETGKVPGEAYQLRPLFRMFGGSSSTNFDLSGSISKILDEQREIRELLHDFDPPIL ISTRRQAFKEKLQQGILNPDDIEVSFESSEIYQETLAKALAKHCGARLLIVDSLLLPGAP VPKEADSVKEVSRPDRVSVFAKRAAHAAGLKHKKPTSSVEAEITGGSTVSSQAPPKQETS TASSRGVIRGPSYGCRGKVVLAFEDNGSSKIGVRFDKSIPDGNDLGGLCEEDHGFFCSAS HLLHLDVSGGDDIDKLAISELLEVASNESKSLPLILFVKEIEKAMVGNSDAYTVLKSKLE NLPENVVVIGSHTQLDNRKEKSHPGGLLFTKFGFNQTALLDLAFPDNLGRLHDRSKETPK TMKQLTRIFPNKVTIQLPQDEALLSDWKQQLERDVETLKAQSNIVSIRLDVVTGNEFEKK LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFSKGQLTKPCKGILLFGPP GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVD SMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRR LMVNLPDAPNREKILRVILAKEDFEPDVDLEAVSSMTDGYSGSDLKNLCVTAAHRPIREI LEREKKERSLAVVENRPQPELYCSSDIRPLKLEDFKHAHEQSTDWPFLFAIRPFACTYD


| Top |