Cherry SNP DataBase

Gene information

Gene Pav_sc0000852.1_g490.1.mk
Chromosome name PAV_r1.0chr1
start 31993561
end 32003316
PAV_r1.0 name Pav_sc0000852.1
start 292149
end 301904
direction -
Annotation NR PREDICTED: LOW QUALITY PROTEIN: chromosome-associated kinesin KIF4A-like
Sequence CDS ATGGAAGCAGGGGAAGATTGCTGTGTGAAAGTAGCGGTCCACATCCGGCCGCTCATCGGA GACGAGAAGCTCCAAGGCTGTAAAGATTGCGTCACTGTCGTCCCCGGCAAGCCTCAGGTA CAAATTGGCACACATTCATTTACTTTCGACAATGTCTACGGGAGTACCGGTTCGCCGTCA TCTGCAATGTTTGAAGAATGTGTTGCTCCGCTGGTTGATGGTTTGTTTCATGGATATAAT GCTACTGTCCTAGCTTATGGTCAGACAGGTTCTGGGAAAACATACACCATGGGCACTGGT TTCAGAGATGGTTGCCAAACTGGAATTATCCCTCAAGTTATGAATGTATTATTTAGCAAA ATCGAAACTCTAAAGCATCAAACTGAATTCCAGTTGCATGTTTCTTTTATTGAGATTCTC AAAGAAGAAGTACGAGACTTGCTGGATCCTAGTTTTTTGAGCAAACCAGAAGGTGCAAAC GGGCATGTGGGAAAAGTAACAGTCCCTGGAAAGCCACCAATACAAATTCGAGAATCATCA AATGGTGTTATTACACTGGCAGGATCCACTGAACTCAGTGTTAGTACGCTGAAAGAAATG GCTGCTTGCCTGGAACAAGGATCTTTGAGCAGGGCAACAGGGAGTACAAATATGAACAAT CAATCAAGCCGTTCACATGCCATCTTCACCATCACATTAGAGCAAATGCATAAGGTCAAC CCAACATGTTCTGGCAACAACGGGGTTAGCGAGAGTATGAACGAAGAATATCTATGTGCC AAGTTGCATTTGGTAGATCTTGCTGGGTCTGAGCGCGCAAAGAGGACAGGTTCTGATGGT TTGCGTTTTAAGGAAGGAGTTCATATTAATAAGGGTCTTCTTGCACTTGGTAATGTTATC AGTGCACTTGGTGATGAGAAGAAGCGCAAAGAAGGCGTTCATGTTCCTTATCGAGATAGT AAACTTACTCGGCTTTTGCAGGACTCACTTGGTGGTAACAGCCGAACTGTTATGATAGCC TGCATCAGTCCCGCTGATATCAATGCTGAGGAAACCCTAAACACTTTAAAGTATGCAAAT CGTGCTCGCAATATCCAAAATAAGCCTATTGTAAACAGAGATCCCATGTCCAGTGAGATG CTGAAGATGCGCCAACAACTAGAGTATTTGCAAGCTGAACTTTGTTCACGTGGAGGAGGA TCTTCTTCTGATGAAATACAGGTTCTCAAGGAAAGGATTACTTGGCTCGAAGCTGCTAAT GAGGATCTTTGTCGGGAACTTCATGAATACCGTAGCAAATGCACTGGTGTAGAGCAGTGT GAAAGAGATGGTCACGTTGGTAGTACATGCTCTGTAAAAAGTGATGGCCTTAAAAGGGGT TTGCAAAGTATAGAATCAGCTGACTACCAAATGGGTGAAGCAATAACAGGTGATTCCCAG GAAATTGATGAGGAAGTAGCAAAAGAGTGGGAGCACAACCTTCTGCAAAATACTATGGAC AAAGAGTTGCATGAATTGAATAAACGTCTACAGCAGAAAGAGTCGGAAATGAAGTTTATT GAAGGTTCTGACACTGTGGCACTCAAGCAGCACTTTGGAAAGAAAATCTTGGAACTTGAA GATGAGAAAAGAACTGTGCAGCAAGAGAGGGACCGGTTGCTGGGTGAAGTTGAAAATCTT GCTAATAGTGATGGACAAGCACAGAAATTGCAAGATGTCCATTCCCAGAAGTTAAAGGCA CTTGAGGCACAGATTTTGGATCTTAAGAAGAAACAAGAGAGCCAGGTTCAGCTACTGAAG CAAAAACAAAAAAGTGATGAAGCAGCAAAGCGACTGCAAGATGAAATCCAGTCAATAAAG GCACAAAAGGTTCAATTGCAACATAGGATAAAACAAGAAGCAGAACAATTTCGGCAGTGG AAAGCCTCTCGAGAGAAGGAATTGCTGCAGTTACGGAAAGAGGGCAGGAGAAATGAATAT GAAAGGCATAAGCTGCAAGCATTAAATCAACGCCAGAAAATGGTTCTTCAGAGAAAGACT GAAGAGGCTGCAATGGCTACCAAGAGGCTGAAAGAATTGCTAGAAGCTCGTAAATCTTCT GCTTGTGACAGCTCAGCTGTTGCCAATGGAAATGGGACACATTTACAGAGCAATGAGAAA TCCTTACAACGGTGGCTTGATCACGAGCTTGAAGTCATGGTGAATGTGCATGAAGTTCGT CATGAATATGAGAAACAAAGTCAAGTACGAGCTGCACTGGCAGAGGAGTTGGCCATGCTG AAGCAATTAAACGAATTCGCTTCAAAGGGCCTTAGTCCTCCAAGAGGAAAGAATGGCATT GCCAGGGTGTCCTCCATGTCACCAAATGCAAGAATGGCCAGAATATCTTCACTTGAGAAC ATGCTTAGCATATCATCAAACTCACTTGTAGCGATGGCATCGCAACTTTCAGAGGCAGAA GAACGGGAGCGTGCCTTTACCAACCGTGGACGTTGGAACCAATTGCGCTCAATGGCAGAT GCAAAGAACTTGCTTCAATATATGTTCAATTCTCTTGCAGATACAAGGTGCCAATTATGG GAGAAGGAAATGGAAATGGATGAAATGAAAGAGCATCTCAAAGAACTCGTAGGTTTGTTG CGGCAGAGTGAGACACGAAGAAAGGAAGTTGAGAAGGAACTAAAATTGAGAGAGCAAGCT GTTGCAACTGTATTGGCAACATCAGCCTCGGCCGACCACCATCAGGGGAACTCACACAAT TCACTGAAACACTGTGCTGATGACACGAGTGGTCCCTTGTCCCCAATCTCTGTGCCAGCA CAAAAACAGCTGAAATATACAGCAGGAATTGTTAACGGCTCTGTCAGAGAATCAATAGCT TTCATAGATCAGACACGAAAGATGGTACCCATCGGGCAGTTGCCAACAAAAAAACTAGCA GTTATAGGACAGGCTGGGAAGCTATGGAGGTGGAAGAGGAGTCATCACCAGTGGTTAGTA CAATTCAAATGGAAATGGCAGAAGCCTTGGAGACTCTCAGAATGGATTAGGCACAGTGAT GAAACAATCATGAGGGCCAAACCTCGTTTACAAGCTCGGTCAAATTATCATCCCAACGCA TGGCATGGGAAAACAGAGAATCAAGTGCAGTGTGCTATAAGTAGCTGTTGA
PEP MEAGEDCCVKVAVHIRPLIGDEKLQGCKDCVTVVPGKPQVQIGTHSFTFDNVYGSTGSPS SAMFEECVAPLVDGLFHGYNATVLAYGQTGSGKTYTMGTGFRDGCQTGIIPQVMNVLFSK IETLKHQTEFQLHVSFIEILKEEVRDLLDPSFLSKPEGANGHVGKVTVPGKPPIQIRESS NGVITLAGSTELSVSTLKEMAACLEQGSLSRATGSTNMNNQSSRSHAIFTITLEQMHKVN PTCSGNNGVSESMNEEYLCAKLHLVDLAGSERAKRTGSDGLRFKEGVHINKGLLALGNVI SALGDEKKRKEGVHVPYRDSKLTRLLQDSLGGNSRTVMIACISPADINAEETLNTLKYAN RARNIQNKPIVNRDPMSSEMLKMRQQLEYLQAELCSRGGGSSSDEIQVLKERITWLEAAN EDLCRELHEYRSKCTGVEQCERDGHVGSTCSVKSDGLKRGLQSIESADYQMGEAITGDSQ EIDEEVAKEWEHNLLQNTMDKELHELNKRLQQKESEMKFIEGSDTVALKQHFGKKILELE DEKRTVQQERDRLLGEVENLANSDGQAQKLQDVHSQKLKALEAQILDLKKKQESQVQLLK QKQKSDEAAKRLQDEIQSIKAQKVQLQHRIKQEAEQFRQWKASREKELLQLRKEGRRNEY ERHKLQALNQRQKMVLQRKTEEAAMATKRLKELLEARKSSACDSSAVANGNGTHLQSNEK SLQRWLDHELEVMVNVHEVRHEYEKQSQVRAALAEELAMLKQLNEFASKGLSPPRGKNGI ARVSSMSPNARMARISSLENMLSISSNSLVAMASQLSEAEERERAFTNRGRWNQLRSMAD AKNLLQYMFNSLADTRCQLWEKEMEMDEMKEHLKELVGLLRQSETRRKEVEKELKLREQA VATVLATSASADHHQGNSHNSLKHCADDTSGPLSPISVPAQKQLKYTAGIVNGSVRESIA FIDQTRKMVPIGQLPTKKLAVIGQAGKLWRWKRSHHQWLVQFKWKWQKPWRLSEWIRHSD ETIMRAKPRLQARSNYHPNAWHGKTENQVQCAISSC


| Top |