Cherry SNP DataBase

Gene information

Gene Pav_sc0000852.1_g510.1.mk
Chromosome name PAV_r1.0chr1
start 32013376
end 32021793
PAV_r1.0 name Pav_sc0000852.1
start 311964
end 320381
direction +
Annotation NR PREDICTED: long chain base biosynthesis protein 1
Sequence CDS ATGGCATCAAGTTTTCTGAACATAGTGAATGCTACTTTAGATTGGGTGACAGCGACTTTG GATGCTCCCTCTTCTCGAGCTATTGTTTTTGGAGTTCCTATTGGCGGACATTTATTTGTA GAAGTTCTTCTTTTCTTGGTCATTGTTTTTCTACTTTCCCAGAAAAGTTACAAGCCACCT AAGCGGCCTTTAACAGAGAAGGAAATAGATGAGCTATGTGAGGAATGGGTTCCTGAATCT CTTATTCCTCCTATCACTGAAGAGATGCAGTGTGAACCCCCAGTGTTGGAAAGTGCTGCA GGGCCACATGCAATAATCAATGGTAAAGAAGTCGTGAACTTTGCTGCAGCAAATTATCTT GGATTGATAGGACATGAGAAATTACTTGAGTCGTGTACCTCTGCATTGGAGAAATATGGT GTTGGTTCCTGTGGTCCTCGTGGGTTTTATGGAACAATTGATGTTCACCTTGATTGTGAG GCAAGAATAGCAAAGTTTTTGGGAACTCCTGACTCAATTCTCTATTCGTATGGACTGTCT ACCATGTTCAGTGCAATTCCCGCTTTTTGCAAGAAAGGAGATATTATTGTTGTGGATGAA GGAGTCCATTGGGGAATACAAAATGGTCTGTATCTTTCTAGAAGTACAATTGTGTACTTC AAGCACAATGACATGGAATCTTTAAGAAATACTCTGGAGAAAATCACTTTGAAGAATCAG CGGGCTAAGAAATTGCGGCGCTACATCGTGGTTGAAGCTGTGTACCAGAATTCTGGCCAA ATAGCCCCCTTGGACGAGATTGTTAAATTGAAGGAGAAATATAGGTTTCGTGTTGTATTG GATGAGAGCAACTCATTTGGTGTGCTTGGAAAAGCTGGAAGAGGTCTCACTGAATTCTGT GGGGTTCCGGTAGAAAAAATTGATATTATTACTGCTGCAATGGGACACGCATTAGCCACA GAAGGAGGATTCTGCACTGGAAGTGCTAGAGTCACTGATCACCAACGATTGAGCAGTTCT GGGTACGTCTTTTCTGCTTCTTTGCCCCCATATCTTGCAAGTGCTGCCATTACTGCCATT GATGTCCTTGAGGAAAACCCTGATCTGATAACAAAGCTGAAGAAAAACATTGCTGTATTA TGGAAAGGTTTGTCAGGTATACTTGGCCTCTCATTAGCGAGCAATCCTGAATCACCCATT GTTTTTCTTAGACTAGAGAAGTCAACGGGTTCTGTGAAGAGTGACCTACAACTCCTTGAA GATATTTCTGACCGTTTGTTGAAGGAATATTCCGTTTTTGTGGTGACCTCCAAAAGGTCA ACCCTTGATAAATGTCGTCTGCCCGTAGGAATTAGATTGTTTGTTTCTGCTGCCCATTTG GAATCTGATCTGCTCAAGGCATCCGAATCGCTAAAAAGGGTTGCAGAATCGCCAGAACAG AAGAGGTCTTGTTTGTTTCTTCCTCGCTCCACACACACAACACAGAGAGAGAAAGAGAGA GAATGTCCGGAGGGATCGCGCGCGGTCGTCTCGCCGAGGAGCGAAAAGCCTGGCGGGTGG AGGCCAGCCATTACAGTGAAGCAAATCCTAATAGGCATTCAGGATTTGCTAGATCAACCC AACCCTGCTGATCCAGCACAAACTGATGGTTATCAGCTCTTCATCCAGGAACCGGCTGAG TACAAGCGAAGAGTGCGGCAGCAGGCAAAGCAATATCCACCTGTTCTTTGA
PEP MASSFLNIVNATLDWVTATLDAPSSRAIVFGVPIGGHLFVEVLLFLVIVFLLSQKSYKPP KRPLTEKEIDELCEEWVPESLIPPITEEMQCEPPVLESAAGPHAIINGKEVVNFAAANYL GLIGHEKLLESCTSALEKYGVGSCGPRGFYGTIDVHLDCEARIAKFLGTPDSILYSYGLS TMFSAIPAFCKKGDIIVVDEGVHWGIQNGLYLSRSTIVYFKHNDMESLRNTLEKITLKNQ RAKKLRRYIVVEAVYQNSGQIAPLDEIVKLKEKYRFRVVLDESNSFGVLGKAGRGLTEFC GVPVEKIDIITAAMGHALATEGGFCTGSARVTDHQRLSSSGYVFSASLPPYLASAAITAI DVLEENPDLITKLKKNIAVLWKGLSGILGLSLASNPESPIVFLRLEKSTGSVKSDLQLLE DISDRLLKEYSVFVVTSKRSTLDKCRLPVGIRLFVSAAHLESDLLKASESLKRVAESPEQ KRSCLFLPRSTHTTQREKERECPEGSRAVVSPRSEKPGGWRPAITVKQILIGIQDLLDQP NPADPAQTDGYQLFIQEPAEYKRRVRQQAKQYPPVL


| Top |