Cherry SNP DataBase

Gene information

Gene Pav_sc0000852.1_g930.1.mk
Chromosome name PAV_r1.0chr1
start 32257516
end 32262897
PAV_r1.0 name Pav_sc0000852.1
start 556104
end 561485
direction +
Annotation NR a-b binding protein
Sequence CDS ATGTTCCAGTTCTTACCATTCACAAAAGGCAAAGCTACGACAATGGGTGGGGCTCCCAGC CGCGAAGATCCCCAGCTTTCAGATTCTGACGAAGAGCAGAGTGAAGAGGAAGAGATCTAC GAGGACGTAGAAGAAAGTGTCGAGGAAAAGCGTCGGAGATCGGCGGAGCGTGGGCCCAAA ACCCCGTCGTCGGTGGACGAAGTAGACGCCATGCTCAAGGCTTTGAAGCTCAAGTACAAC CCAAATGTCAAAAATCCGGTCAAGCTCTACCATTTTGTCGCTGGAGACACCCCTCAAGCC AAAGGAAAATGGGTAACCTCCGAAAAGCTCACTTCTTACTCTTTTAGAAAGACCTCTCGA ATGGAAATTGATAATGACGATGGTGAGGAAGAAGACGAATCTGATGAGGAAGGCGGGGAT TCCTGGTGGATTTTGAGTGTTGGTGACCCTGACAAGATTCGGGCTAAAGTTAAGGTCTCG GACGAAATGCAGTTGAATGGCGATCAACGCCGTGTTGATTTTATTGCCTGCGCACCAACG CGAGGTGTGTGGGCAATGAAGTTTTATACTGATGAGGACTATAGGGCGTTTGTTGCAAAG TACAAAGATTGTTTGTTCGAGAACACGTATAGGTATGAGGCCACAGATGAGAACAGGGTT AAGGTTTATGGGAAAGATTTTCTTGGGTGGGCCAAGCCGGAAGTGGCTGATGATTCAGTG TGGGAAGATGCAGAGGATAGTTTATCGAAGAGCCCAGGCTCCGCAACACCATTGAGAGCA AATGAAGACTTGAGAGAGGAGTTTGAGGAGGCTTCCAATGGTGGTATACAGAGCTTGGCA TTGGGTGCATTGGACAATAGTTTCTTAGTGGGGGAGTCTGGCATTCAGGTTGTTAAGAAT TTTAGTTATGGAATTCAGGGGAAAGGTGTTTATGTCAATTTTGATGATGGAGGTTATAGA GGTGGTTCGAGTTTGGCACGGTCAACACCTAGGAAGGCTCTGCTAATGAAGGCCGAGACC AACATGCTCCTTATGAGTCCTATGAATGAAGGGAAGCCTCATACAACAGGTCTCCATCAG TTTGATATTGAAACTGGGAAGGTTGTTACAGAGTGGAAGTTTGAGAAAGATGGGACTGAT GTTACAATGAGGGATATAACAAATGACAGTAAGGGAGCACAGTTGGACCCTTCGGGATCA ACATTTTTGGGATTGGATGATAACAGGCTTTGCCGGTGGGATATGCGTGATAGGAAAGGG ATGGTTCAGGACCTTGCAGCAGCTAGTGGCCCTGTTCTCAATTGGAACCAAGGGCATCAG TTCTCCAGAGGGACGAACTTTCAGTGCTTTGCTAGCACTGGTGATGGCTCAATTGCTGTT GGGTCCCTTGATGGGAAGATCCGGTTGTATTCGAACAGTTCGATGAGGCAGGCGAAAACA GCTTTTCCAGGCCTTGGTTCGCCTATTACTCATGTGGATGTTACCTTTGATGGGAAGTGG ATTTTGGGCACAACGGACACCTATTTGATCCTCATCTGCACCATCTTTGCTGATAAGGAT GGGAAGACAAAGACTGGTTTTGGTGGGCGTATGGGGAATAGAATTTCAGCTCCAAGACTG TTAAAGCTGAGTGCTGTGGATTCACATTTAGCTGGTGTTAATAATAAGTTTCGTAATGCT CAGTTTTCGTGGGTCACTGAGAATGGGAAGCAGGAGCGTCATTTAGTTGCAACTGTGGGC AAGTTTAGTGTGATTTGGAACTTTCAACAGGTGAAGGATGGTTCACATGAGTGCTACCGC CACCAGGAGGGCTTGAAGAGCTGCTATTGCTACAAGATAGTCCTTAAGGATGATTCCATT GTTGACAGTCGCTTCATGCATGACAAATTTGCAGTTACCGACTCACCTGAGGCGCCACTT GTGATTGCAACCCCGATGAAAGTTAGCTCCTTCAGCATATCCAATAGAAGCAGAGAAATG GCAGCGGCAGTGGGGGGGAGAGGTTTCCTTGTGCAGCCATGCTCTTTATCCTTTGTTTCT AATAAGAACGTACTGAAGCACCCATTTGGTGCAGCAAACACTTGCTGGCATGTCAAACCA GCAAAACCTCAAGGTTTTGCCCGACACGTGGCGCATGCCCAGCTGCGCCCTACATGGCTC CCTGGGCTCGACCCCCCACCCTACCTTGATGGAAGCTTGGCTGGGGATTTTGGGTTTGAC CCGCTTGGGCTTGGGGAGGACCCGGAAAGCTTGAGGTGGTATGTGCAGGCAGAGCTGGTT CATGCTCGCTTTGCAATGCTTGGAGTTGCAGGAATTCTTCTAACAGATTTACTGCGTGTA ACAGGGCTTCTCAGTATACCAGTTTGGTACAACGCAGGTGCAGTAAAATTTGGCTTTGCC AATACAGAAACTCTGTTCCTTGTCCAACTAATCTTGATGGGATACATGGATTTCAAAAGT CCTGGATCTCAAGCCCAAGACGGTTCCTTCTTCGGATTGGAAGCTGCACTAGAAGGTTTA GAACCTGGATATCCTGGTGGGCCTTTGTTAAATCCTCTTGGTCTGGCAAAAGATATAAAG AATGCTCATGAATGGAAGCTTAAAGAGATTAAGAATGGGCGCCTTGCAATGGTAGCCATG CTTGGCATCTTTGTGCAAGCTTCTATTACTCATGTAGGACCAATTGATAATCTTGTGGAG CACCTATCCAACCCATGGCACAGAACCATTGTTCAGACTCTTGCTAACTCTGCTTCTTAA
PEP MFQFLPFTKGKATTMGGAPSREDPQLSDSDEEQSEEEEIYEDVEESVEEKRRRSAERGPK TPSSVDEVDAMLKALKLKYNPNVKNPVKLYHFVAGDTPQAKGKWVTSEKLTSYSFRKTSR MEIDNDDGEEEDESDEEGGDSWWILSVGDPDKIRAKVKVSDEMQLNGDQRRVDFIACAPT RGVWAMKFYTDEDYRAFVAKYKDCLFENTYRYEATDENRVKVYGKDFLGWAKPEVADDSV WEDAEDSLSKSPGSATPLRANEDLREEFEEASNGGIQSLALGALDNSFLVGESGIQVVKN FSYGIQGKGVYVNFDDGGYRGGSSLARSTPRKALLMKAETNMLLMSPMNEGKPHTTGLHQ FDIETGKVVTEWKFEKDGTDVTMRDITNDSKGAQLDPSGSTFLGLDDNRLCRWDMRDRKG MVQDLAAASGPVLNWNQGHQFSRGTNFQCFASTGDGSIAVGSLDGKIRLYSNSSMRQAKT AFPGLGSPITHVDVTFDGKWILGTTDTYLILICTIFADKDGKTKTGFGGRMGNRISAPRL LKLSAVDSHLAGVNNKFRNAQFSWVTENGKQERHLVATVGKFSVIWNFQQVKDGSHECYR HQEGLKSCYCYKIVLKDDSIVDSRFMHDKFAVTDSPEAPLVIATPMKVSSFSISNRSREM AAAVGGRGFLVQPCSLSFVSNKNVLKHPFGAANTCWHVKPAKPQGFARHVAHAQLRPTWL PGLDPPPYLDGSLAGDFGFDPLGLGEDPESLRWYVQAELVHARFAMLGVAGILLTDLLRV TGLLSIPVWYNAGAVKFGFANTETLFLVQLILMGYMDFKSPGSQAQDGSFFGLEAALEGL EPGYPGGPLLNPLGLAKDIKNAHEWKLKEIKNGRLAMVAMLGIFVQASITHVGPIDNLVE HLSNPWHRTIVQTLANSAS


| Top |