Cherry SNP DataBase

Gene information

Gene Pav_sc0000882.1_g010.1.mk
Chromosome name PAV_r1.0chr2
start 5436938
end 5441973
PAV_r1.0 name Pav_sc0000882.1
start 25
end 5060
direction +
Annotation NR PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g76280-like
Sequence CDS ATGCAAAAATTTGGGTTGCAGCCGTCAAGCCATACATATGATGGCTTTGTCAGAGCAGTT ACTTCTGAGCGAGGTTTCAGTAGTGGAATGGAAATTTTAAGAATTATGCAGCAGAGAAAT TTGAAGCCGTATGATTCTACTCTGGCAAGCCTTTCTATAGGTTGCAGCAAAGTGCTCGAA TTGGATTACGCTGAGGCTCTGCTGGATCAAATATCTGAATGTTCATATCCACATCCTTTC AATGCTTTTCTTGCAGCATGTGACACAGTGGATCAACCTGAACGAGCAGTGCAGATGTTG GCTAAAATGAAACAATTAAAAGTTATGCCTGATATTAGGACATACGAGCTGCTGTTTTCA TTATTTGGTAACGTGAATGCCCCATACGAAGAAGGTGACATGTTGTCACAGGTGGATGCT GCTAAACGTATTAATGCTATAGAAATGGATATGGCCAGATATGGTATTCAGCACAGTTAT TTATCAATGAAGAACTTGTTGAAAGCACTTGGAGCAGAGGGGATGATAAGAGAGCTGATC CAGTATTTGGACGTGGCAGAGAATATATTTTGTCGTAATAACATTTATCTGGGAACACCT ATTTATAATACGGTGCTGCATTCACTTGTTGAGGCTAAGGAAAGTCAAATGGCAATTAAG ATATTTAAAAATATGAAGTCATTTGGTTTCCCTGCAGATGCTGCGACTTATCATATAATG ATTGATTGTTGTAGCATTCTAGGATGTTACAGATCTGCTTGCGCATTGGTCTCCATGATG TTGCGAGATGGCTTTTATCCACTAACAGTGACTTATACCATTCTCATAAAGATTCTGTTG GAAGATGATGACATTGAGGAAGCATTGAATCTTTTGGATCAAGCCAGTTCAGAACGCAAT GAACTTGATACCTTGCTATTTAATACCATTCTTGAAAAAGCCTGTGAAAAGGAAGTGATT GAGGTAGTTGAATTTGTCGTTGAGTGGATGCACCATGAAAAAGTCCAGCCGGATCCAGCG ACCTGCCATTTTGTTTTCTCTGCATATGCCAACAGTGGTTTTCACAGCACGGCCATGGAA GCACTGCAGGTTTTGAGTATGCGCATGATATGTGAAGAAGATGGTAGCTTTCCAGAAAAG GCAGAATTTGAGGATGACTTCATCTTTGCTGAAGACACGGAAGCTGAATCACGAATAGTA CAGCTTTTTAAAGGTTCTGAAGAGAACCTCCAATTTCATGGTCACCTAATCAAAGCTCAT GGGCCAGAAGACTGTCATCTAACTACACTGCCAGGA
PEP MQKFGLQPSSHTYDGFVRAVTSERGFSSGMEILRIMQQRNLKPYDSTLASLSIGCSKVLE LDYAEALLDQISECSYPHPFNAFLAACDTVDQPERAVQMLAKMKQLKVMPDIRTYELLFS LFGNVNAPYEEGDMLSQVDAAKRINAIEMDMARYGIQHSYLSMKNLLKALGAEGMIRELI QYLDVAENIFCRNNIYLGTPIYNTVLHSLVEAKESQMAIKIFKNMKSFGFPADAATYHIM IDCCSILGCYRSACALVSMMLRDGFYPLTVTYTILIKILLEDDDIEEALNLLDQASSERN ELDTLLFNTILEKACEKEVIEVVEFVVEWMHHEKVQPDPATCHFVFSAYANSGFHSTAME ALQVLSMRMICEEDGSFPEKAEFEDDFIFAEDTEAESRIVQLFKGSEENLQFHGHLIKAH GPEDCHLTTLPG


| Top |