Cherry SNP DataBase

Gene information

Gene Pav_sc0000882.1_g300.1.mk
Chromosome name PAV_r1.0chr2
start 5278599
end 5291279
PAV_r1.0 name Pav_sc0000882.1
start 150719
end 163399
direction +
Annotation NR PREDICTED: polygalacturonase
Sequence CDS ATGCAAATGTTTTTGTATCCAAAACTTTTGAAAGCTCAGATGAATTCACAAAGCCATTTT CTCTCCATACTTCTGATAGTTTTCTTAGCCTCTTTTTCCTTCTCTTTTAGCAGTAACGTC CCAGAGGACCCACTTGTACTTGATCATCATCACCATCAAACTAATTCTAGTGGTGATCAT GATGAATATATAAAACCCTCCCCTACAATATCAAGGACAAGCAGGCTAGCTATTCTCAGC AGAGCAAGTGCTGCTCATCATTCAGCTTCAGCAAAGCATATTGTTGTTATTGTGGATACT TTTGGAGCTAAGGGAGATGGCGGGGATGATACCCAGGCGTTTAGAAAAGCTTGGACGAAG GCTTGTTCTTCTCAAAGGGGCGTTGATCTCGTGGTTCCTAAGAACAGGAACTATCACCTG AAACCAAACAATTTCTCTGGTCCTTGCAAATCTCCTATCACGCTCAAGATCTATGGAACA ATCAAAGCCTCTCCCAACCGATCAGATTACAGAAATGACAGACGGCACTGGATTGTGTTT GAAAATGTGACAAACTTTAGAGTCGAAGGTGGTGGCACCATCGATGGAAATGGAAGGATA TGGTGGCAAAACTCTTGCAAGGTTAACGAAGCCCTTCCTTGCACGATCGCACCAGATGCC ATGACTTTCTTCGGGTGCATCAACTTGCAAGTAGACAATATAAGGTTCCAAAATCCCCAA AAAATGCATCTTTTGTTTCGCGAATGTGTGAATGTGAAAGCTTCGAATCTCATAGTAACA GCACCAGAGGATAGCCCCAACACAGATGGAATTCATGTCACAGGAACACAAAATATTCAG ATAAAGAATTGTCTCATTAGGACAGGGGATGATTGTATTTCAATAGTAAGTGGGTCACGA AATGTTCAAGCCACGGATATAATCTGCGGACCAGGGGATGATTGTATTTCAATAGTAAGT GGGTCACGAAATGTTCAAGCCACGGATATAATCTGCGGACCAGGTCATGGAATCAGCATT GGAAGCTTAGGTGCTGGGAATTCAGAAGCAGAGGTTTCAGATGTGATAGTTTCTGGAGCG AAAATGACGGACACCACCAATGGACTAAGAATAAAGACTTGGCAGGGCGGTTCTGGATAT GCCTACAACATCAGATTCAAAAATATTATGATGGACAACGTGAGCAATCCAATAATCATA AACCAATATTACTGTGATCAGGACGAGCCATGTCAAGAACAGGCTTCAGCTGTGAAAATA AGCAATGTGGTGTATGATAACGTAAAAGGCACAAGTGCTTCAAAAGTGGCAGTGAAATTT GACTGCAGCAAGCGCTTCGGATGCAAAGGAATCTTGTTACGAAACGTTAACATACAAACT CTAGGCGAAGGAACAGCCATAGCTTCCTGTGAGAATGTTAGACTAAGCCATAGTGGGAGT ATGAATTCACAAAGCCATTTTCTCTCCATACTTCTGATAGTTTTCTTAGCCTCTTTTTCC TTCTCTTTTAGCAGTAACGTCCCAGAGGGCCCACTTTTACTTGATCATCATCACCATCAA ACTAATTCTAGTGGTGATCATGATGAATATATAAAACCCTCCCCTACAATATCAAGGACA AGCAGGCTAGCTATTCTCAGCAGAGCAAGTGCTGCTTATCATTCAGCTTCAGCAAAGAAT ATTGTTGTTAATGTGGATAGTTTTGGAGCTAAAGGAGATGGCGGGGATGATACCCAGGCG TTTATAAAAGCATGGAAGAAGGCTTGTTCTTCGCAAAGGGGCGTTGATCTCGTGGTTCCT AAGAACAGGATTTATCACCTGAAACCAATCAATCTCTCTGGTCCTTGCAAATCTCCTATC ACCCTCAAGATCTATGGAACAATCAAAGCCTCTCCCAACCGATCAGATTACAGAAATGAT ACACGGCATTGGATTGTGTTTGAAAATGTGGCAAACTTTAGAGTCGAAGGTGGTGGCACC ATCGATGGAAATGGAAGGATATGGTGGCAAAACTCTTGCAAGGTTAACGAAGCCCTTGCC ATGACTTTCTCCGGGTGCATCAACTTGCAAGTAGACAATGTAAGGTTCCAAAATCCCCAA AAAATGCATCTTCGGTTTCACAAATGTGTGAATGTGAAAGCTTCGAATCTCATAGTAACT GCACCAGAGGATAGCCCCAACACAGATGGAATCCATGTCACAGGAACACAAAATATTCAG ATAACGAACTGTCTCATTAGGACAGGGGATGATTGTATTTCAATAGTAAGTGGGTCACGA AATGTTCGAGCCACGGATATAATCTGCGGACCAGGTCATGGAATCAGCATTGGAAGCTTA GGTGCTGGGAATTCAGAAGCAGAGGTTTCAGATGTGATAGTTTCTAGAGCGAAAATGATG GGTACCACCAATGGATTAAGAATAAAGACTTGGCAGGGCGGTTCTGGATATGCCAACAAC ATCAGATTCAAAAATATTATGATGCACAACGTGAGCAATCCAATAATCATAAACCAAAAT TACTGTGATCGGGACGAGCCATGCCAAGAACAGCGCTTCGGATGCAAAGGAATCTTGTTA CGAAACGTTAACATAAAACCTCTAGGCGAAGGAACGGCCAATGCTTCCTGTGAGAATGTT AGACTAAGCCATAGGGGGAGGTCACAATATAAATGA
PEP MQMFLYPKLLKAQMNSQSHFLSILLIVFLASFSFSFSSNVPEDPLVLDHHHHQTNSSGDH DEYIKPSPTISRTSRLAILSRASAAHHSASAKHIVVIVDTFGAKGDGGDDTQAFRKAWTK ACSSQRGVDLVVPKNRNYHLKPNNFSGPCKSPITLKIYGTIKASPNRSDYRNDRRHWIVF ENVTNFRVEGGGTIDGNGRIWWQNSCKVNEALPCTIAPDAMTFFGCINLQVDNIRFQNPQ KMHLLFRECVNVKASNLIVTAPEDSPNTDGIHVTGTQNIQIKNCLIRTGDDCISIVSGSR NVQATDIICGPGDDCISIVSGSRNVQATDIICGPGHGISIGSLGAGNSEAEVSDVIVSGA KMTDTTNGLRIKTWQGGSGYAYNIRFKNIMMDNVSNPIIINQYYCDQDEPCQEQASAVKI SNVVYDNVKGTSASKVAVKFDCSKRFGCKGILLRNVNIQTLGEGTAIASCENVRLSHSGS MNSQSHFLSILLIVFLASFSFSFSSNVPEGPLLLDHHHHQTNSSGDHDEYIKPSPTISRT SRLAILSRASAAYHSASAKNIVVNVDSFGAKGDGGDDTQAFIKAWKKACSSQRGVDLVVP KNRIYHLKPINLSGPCKSPITLKIYGTIKASPNRSDYRNDTRHWIVFENVANFRVEGGGT IDGNGRIWWQNSCKVNEALAMTFSGCINLQVDNVRFQNPQKMHLRFHKCVNVKASNLIVT APEDSPNTDGIHVTGTQNIQITNCLIRTGDDCISIVSGSRNVRATDIICGPGHGISIGSL GAGNSEAEVSDVIVSRAKMMGTTNGLRIKTWQGGSGYANNIRFKNIMMHNVSNPIIINQN YCDRDEPCQEQRFGCKGILLRNVNIKPLGEGTANASCENVRLSHRGRSQYK


| Top |