Cherry SNP DataBase

Gene information

Gene Pav_sc0000884.1_g090.1.br
Chromosome name PAV_r1.0chr4
start 10428920
end 10430384
PAV_r1.0 name Pav_sc0000884.1
start 14807
end 16271
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103327674
Sequence CDS ATGCGCCACAACTCTACTGAATATGTCAAGAGATGTGATCGCTATAAGCGGTACAAACCA GTTCCTAACATGTCTACTGAAATCTACCATCTGCAGAATAGTCTGTGGCCTTTCATGCAA TCGGCCTGTCTGCCGCGCAAATCTCACGGCCTGGAGTTCCGGGCCGAGGGGACGTGCGTT AACACGGGGTTTCCTGCTTTTGGGTGCGGTGCGGTTGTGCGCGGGCGTGCCAGCACGGTT TACCCGTCTTTCGAGAGACGTAGGGCGACGACCAGAAGCGTCCTTCGGGAGACGCAGCCC GCAAAGAAGCGTCCTCAGGGAGACGCAGGATGCACTAGAAATTTCCTAAGGGAGGTCTCC ATGATTCCTAAAGGAGGCATTCAGGTTCCTATTCGTTTCCTAAGGGGGGCAGGATAG
PEP MRHNSTEYVKRCDRYKRYKPVPNMSTEIYHLQNSLWPFMQSACLPRKSHGLEFRAEGTCV NTGFPAFGCGAVVRGRASTVYPSFERRRATTRSVLRETQPAKKRPQGDAGCTRNFLREVS MIPKGGIQVPIRFLRGAG


| Top |