Cherry SNP DataBase

Gene information

Gene Pav_sc0000884.1_g260.1.mk
Chromosome name PAV_r1.0chr4
start 10369375
end 10377392
PAV_r1.0 name Pav_sc0000884.1
start 67799
end 75816
direction -
Annotation NR PREDICTED: nucleolar complex protein 3 homolog
Sequence CDS ATGGTGGCAAAGTGGAAGCAAAAGCAGAGGATCATTCTACCTCCTGAGCTCCCACCGGAG GTCTCGGAGGACGAAATTGAAGTCTCGGACGAGGACAGGGATTTTGTCGATCAAAACCGA GAATTCGCTGGCTTTCTCACCACCTTAGACACCCAGTCCATCACCAAGCATGTTACCCGC GTTGCTGATGTAAAAGAGGATGCTTTGGAAGCTTTGTATGAAAAGCGCTTAAAAAGAAAA TCCTTGCAAAAAGAAAAAGAGGATCCTGGGATTCAAGTTGATCGTGTAGATGCTCTTCCT GTTAAAACCTTAGATGGACAACTCTACTATCGAACAGCAACGAAGGCATCAAAAGCATCT GAAAACGATCCCACTGAAGAGGAAGCAAGTGGTGCTGCAGATAAAAGCATAGTTAAGCTG ACAAAGGCTGAAAGGAGGGCAAAGCTTAAGAAAAGTAAGAAAGAGGCTAAGAAACAAGGA AAGGAGGCCGAACCCGAAGTCGAACAAACTCCACAAGAAGCAGTGCTGGTATCATCTGAT TGGACTAGTTATTCTTCTGCTGAGGTTAAAGAAGATCTTACAGCTGAAGAAGCCTTTGAA AGTAAGAAGAACAAACTTGCAGAGCTGGGAATCGCTCTGCTTGCTGATCCAACTTCCAAT ACAAAATCTCTGAAGGAGATATTACAGATCTGTAAAGATAATAATCATGCCATTGTCAAA CTTGGGCTCCTATCTCTGTTGGCTGTTTTTAAAGACCTTATTCCTGGATATCGGATTAGG CTTCCTACTGAGAAGGAGCTAGAAATGAAGGTCTCAAAGGATGTTAAGAAAATGCGGTTT TATGAATCAACACTGCTATCTGTATACAAGGCATACCTGCAGAAGTTGGCAGCATTAGAA AAGCAGTCCTCATTTCAGCATGTGGCATTTCGCTGTATCTGTACATTGCTTGATGCAGCT CCCCACTTCAACTACCGGGAGAGCTTGTTAGGTGTTGTCATCAGAAACATAGGCTCCCCA GATGATGTTATAAGGTTTTGCTCTATCTTTAGTTTTTGTTCCCTAATGTATCATTTTGGT AAGTTGTCTTACAAGGTGTCTTTGAAGACTGCATGGGTGTTAAAACACCCTCTTTTGCTT AGAAACAGTTCAACATTGCCAAGGAAACTATGCTGTTCTACCATCAAGTCTCTGTTTACA AATGAGGGAAAACACGGTGGTGAAGCAACTGTGGAGGCTGTTCGATTAATTGCAGATCAT GTTGCTGCTGATTACAAGGCGGTTGCTTTTACCCCAGATGTTATGGAGCGGAGAGGAATG CAGACAGAGGCACTTTCTGCTGTATTTGAAACATATTTTCGCATATTGAAACATACGATG CACTCATCAACTTCCAGATCTGAAGCAAATGCTAGTTTATCTACTGGTGCATCTGAGCCC CACCCTTTACTTGCTCCGTGTCTGAAAGGATTAGGAAAATTCTCGCATCTAATTGACATG GATTTCATGGGGGATCTTATAAACTATCTGAAAAAGCTTGCTTCTGGTGGTAGCGATTCT GAGAATACTTCAAAATGTTTGACTGTATCTGAGCGCTTCCGTTGCAGCATTGTTGCATTT ACAGTGATGAAGAGCAACCTTGATGCCTTAAATGTTGATCTACAGGACTTCTTCGTCCAG CTTTACAATATTATACTTGAATATAGGCCTGGAAGAGATCAGGGCGAAGTATTAGCTGAA GCTCTGAAGATGATGCTGTGTGAAGATAGACAACATGACATGCAGAAGGCTGCTGCATTT GTAAAGCGTTTGGCCACATTCTCATTATGTTCCGGATCCGCAGAGTCCATGGCTGCTTTG GTTACTTTAAAGCATCTTCTTTTGAAGAATGTCAAGTGCCGGAATCTGTTAGAAAATGAT GCTGGAGGTGGCTCAGTGTCAGGTTCTGTCGCTAAATATCACCCATATGCTTCGGACCCC AATTTAAGTGGTGCTCTTGCTTCAGTCCTTTGGGAACTCAATCTTCTAACCCAGCATTAT CATCCAGCTGTCTCAAGTATGGCTTCAAGTATATCTAGCATGAACGCTGCTACTAACCAG GTTTATCTCTCAACCATTTCTCCTCAACAAGCTTTCACGGACTTTTCCTTGGAGAGGCCA GAGTCTTTCAAGCCACCGAGTGAAGTGACCCTTCTGTATCAGCTGGGATAG
PEP MVAKWKQKQRIILPPELPPEVSEDEIEVSDEDRDFVDQNREFAGFLTTLDTQSITKHVTR VADVKEDALEALYEKRLKRKSLQKEKEDPGIQVDRVDALPVKTLDGQLYYRTATKASKAS ENDPTEEEASGAADKSIVKLTKAERRAKLKKSKKEAKKQGKEAEPEVEQTPQEAVLVSSD WTSYSSAEVKEDLTAEEAFESKKNKLAELGIALLADPTSNTKSLKEILQICKDNNHAIVK LGLLSLLAVFKDLIPGYRIRLPTEKELEMKVSKDVKKMRFYESTLLSVYKAYLQKLAALE KQSSFQHVAFRCICTLLDAAPHFNYRESLLGVVIRNIGSPDDVIRFCSIFSFCSLMYHFG KLSYKVSLKTAWVLKHPLLLRNSSTLPRKLCCSTIKSLFTNEGKHGGEATVEAVRLIADH VAADYKAVAFTPDVMERRGMQTEALSAVFETYFRILKHTMHSSTSRSEANASLSTGASEP HPLLAPCLKGLGKFSHLIDMDFMGDLINYLKKLASGGSDSENTSKCLTVSERFRCSIVAF TVMKSNLDALNVDLQDFFVQLYNIILEYRPGRDQGEVLAEALKMMLCEDRQHDMQKAAAF VKRLATFSLCSGSAESMAALVTLKHLLLKNVKCRNLLENDAGGGSVSGSVAKYHPYASDP NLSGALASVLWELNLLTQHYHPAVSSMASSISSMNAATNQVYLSTISPQQAFTDFSLERP ESFKPPSEVTLLYQLG


| Top |