Cherry SNP DataBase

Gene information

Gene Pav_sc0000888.1_g080.1.mk
Chromosome name PAV_r1.0chr4
start 26655098
end 26662285
PAV_r1.0 name Pav_sc0000888.1
start 60749
end 67936
direction -
Annotation NR PREDICTED: filament-like plant protein
Sequence CDS ATGGACAGGCGGAGTCGGCTATGGCGAAGGAAGTCATCAGAGAAGAGTCCCGGCGAGACT GAGAGTTCAGGATCGATGTCTTCTCATTCTGAAAGATTTTCTGATGATCAGGCAAATCCA ACTCATAGCACTCTATTGCCAGAAGTCACTTCTAAAGCTCCACGCATTGAAGAAGAAGAT AATGAAAGTGTCGAGACTTTGACAGAGAAATTATCAGCCGCCATTCTTAATAGTAGTGCC AAAGATGAGTTGGTAAAGCAGCATGCTAAAGTTACAGAAGAAGCTGTCTCAGGCTGGGAG AAGGCTGAAAATGAAGTGTTGGGTTTAAAACAGCAACTTGAGGCTGCAAATCAGAAAAAC TCAGCTCTTGAAGACCGAGTTGGTCATCTTGATGGAGCACTAAAGGAATGCGCTACTGAA AAAGAGAACTCTGCTCTTCAACTTAAGCTTCTTTCTCGAGTGAAGGAGCTAGAAGTCAGG ACTATAGAGAGGGATTTGAACGCACAAACTGCAGAAACAGCCAGTAAGCAATATTTAGAG AGCATAAAGAGGGTGTCCAAGCTTGAAGCTGAGTGCCGTAGGCTAAAAGCCTTGACTCGT AAAACATTGCCTGCTAATGATCACAAACCGTTTTCTACATCCTCAGTATACATAGAATCT TTTACAGATAGCCAGTCAGATAGTGGGGAGAGGGTACTGGCAATTGATCCAGATCCACAT AAAGTGAGTGGCTTGTATCCAAGTCAATATGATCCAAGCCAGTCAGATTCACGGGCATCA GCTCAAATCACAGAACATGGTCAGTTTAAGAATGAGAAGGATTTTGGAAAAAATCTTATG GACCCTTCAGAAGAAATCAATCTCATGGATGATTTTCTTGAAATGGAGCGGCTTGCTGCA TTGTCAGATACAGAAAATGACAGCTGTCATCTTGAGTTGGGAATTGAATATCAACCTCAA ACTGGAGAAAACCCTTTAAAAACTGAATTTGAAACCATGATTCAAAGGGCCGCGGAACTT GAGAGGAAGTTAGAGAAGATGGCAGCAGAAAAAGTGGAACTTGAGATGACTCTGACTGAG TGTCAAAAGCAGCTTGAGACATCACAAAGTCAACTAGTGGAGGCTGATATGAAGTTGGAA GACCTTAAAAGAGAGTTAGCTCTTGCAAATGACTCAGTGTATGCTGCAGATGAGGAAGTA AAGACTTATCAAACAATGAGAGTAGTGGCAGAGTCGCAACTAAGAGCTATTCAAACTGAA TTCAACTCCTTGCTTTTAAAAGTTGGTTCACTAGAAGAAGAGGTTTGGAAGGAGCGAAAT TTGTCAGCTGAAAATGTGGCCAAATGCCAGAAACTGGAGAATGAACTATTTAGTATGACA CATGAAGCTGAGCGCCAGCGTGAGGTTGAGCTCCAGCGGTTGGCCAGTACTAATGGTGAA TTGAAGATAAAGCAGGAGAAAGAACTAGCATTGGCTGCGAATAGATTTGCGGAGTGCCAG AAAACAATTGCATCTCTTGGCCAACAGTTGAAGTCACTTGCAACTCTGGAGGACATCCTG GTGGACTCTGAGAGGCCACCAGAGCTCATTGAAGAAGGAATGCAGTGCCACATAAATAGT GTGGAACCACGTAATTTACACCCAAACCTGAATACTGCAAGGGTAGTATAA
PEP MDRRSRLWRRKSSEKSPGETESSGSMSSHSERFSDDQANPTHSTLLPEVTSKAPRIEEED NESVETLTEKLSAAILNSSAKDELVKQHAKVTEEAVSGWEKAENEVLGLKQQLEAANQKN SALEDRVGHLDGALKECATEKENSALQLKLLSRVKELEVRTIERDLNAQTAETASKQYLE SIKRVSKLEAECRRLKALTRKTLPANDHKPFSTSSVYIESFTDSQSDSGERVLAIDPDPH KVSGLYPSQYDPSQSDSRASAQITEHGQFKNEKDFGKNLMDPSEEINLMDDFLEMERLAA LSDTENDSCHLELGIEYQPQTGENPLKTEFETMIQRAAELERKLEKMAAEKVELEMTLTE CQKQLETSQSQLVEADMKLEDLKRELALANDSVYAADEEVKTYQTMRVVAESQLRAIQTE FNSLLLKVGSLEEEVWKERNLSAENVAKCQKLENELFSMTHEAERQREVELQRLASTNGE LKIKQEKELALAANRFAECQKTIASLGQQLKSLATLEDILVDSERPPELIEEGMQCHINS VEPRNLHPNLNTARVV


| Top |