Cherry SNP DataBase

Gene information

Gene Pav_sc0000890.1_g860.1.mk
Chromosome name PAV_r1.0chr1
start 29422530
end 29430838
PAV_r1.0 name Pav_sc0000890.1
start 440443
end 448751
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103320920
Sequence CDS ATGAGGAGGACCGGCGCTCTCCCCTTCTCCCTCATCCTCTTCCTTATATTCCCACTTCAA TCAATTCTTGCTTTTAATTCTTCCACCACCCAAATCTTGCAGGATGTGTTAAAGAAAATA TCGGCCAAGCACAAGTGGTATTTGCAGGACATCAGGGTTTCGAGGTTGGATGCCAGCAGG GTTCGCTTCGGGAGCGCCCAGCGATATGAGTTCCGGGTCGGATTCGGGAAGATCCCCGTA GGGGTCCTGTTCTCCGACGACGTCTCTTCCTGGAAAAAGTTCAGGCAACCCAGAACCCAT TTTGGCTCTCTCGTTAAGGAGCTCAGCTCCATGGCTGTAGTTGACACCTTCAAAGTGGAG GGTCCCTTTGAGTTACGGGTCGGCGGCACCCATCACCTCTCCCTTTCATTGCCGATGAAC ACTACATATAGTGGGTTTAAAAGGGTTCTTGTTGGTAAAGGCATCACTGTTGAAGTAAGT GGAGCTACAGAAGTCTCTGTGTTTCATGCATCTGATCTTGGTTTATCATCAAAGGGAAGT GGTGCTATTGGCAAGGAGAAAAGTGAGTTTTGGCCTATTTGGCATTCATACTGCACACCA TTATTTCCTATTCGTGTTTTAGGGCCTGCAACGTTGGTTGCATACAAGACTCGAAATCCT GATGCCCACATTGAGACCAAATTTATGTCCAAGGAGATAATTGAGTTCTTGCCAGAGAAG TGCTACAGAAGCCATGCTTACAAGAAACGGGCTTGCCCCATTGATTCTTTACGTTTGAGG ATATCTATGCTGGAAAGAATTTGGAAAAGCTTTCTTGGTGATAGAATTCGCCAAAGCGGT TTGTCGGGATTTGTTGAAGGGAAAATCAAAGCTTCGACTGTTGTCCGTTTCAAGCTTGAG ATCGAAAAGGAATTTCGGAGGAATGGTGCACTCCAGGGCAAGGCAGGATGGAGAACTAGG CCGGCTGTTGAACGGGTTTGGTATGAAGTTTTGGCAAGAGTGGAATTTGGGAGGGTGAAG CCTCTCTTGGTTAAAAAGATTAGGCCCTTCATTGTGGCAGATTCAGTTGCGTGGAGTAGT TTGATGTCCAATATTTCCTTCACCAAGTCCTCATCTGTCCTTGTACCTTCTGAGGCGCTA ACGTTGGATGTGAAGTGGCTCTCCTTTGTTGTCCTTCTCCCCTCTTGGCATCTGTCTATC TGA
PEP MRRTGALPFSLILFLIFPLQSILAFNSSTTQILQDVLKKISAKHKWYLQDIRVSRLDASR VRFGSAQRYEFRVGFGKIPVGVLFSDDVSSWKKFRQPRTHFGSLVKELSSMAVVDTFKVE GPFELRVGGTHHLSLSLPMNTTYSGFKRVLVGKGITVEVSGATEVSVFHASDLGLSSKGS GAIGKEKSEFWPIWHSYCTPLFPIRVLGPATLVAYKTRNPDAHIETKFMSKEIIEFLPEK CYRSHAYKKRACPIDSLRLRISMLERIWKSFLGDRIRQSGLSGFVEGKIKASTVVRFKLE IEKEFRRNGALQGKAGWRTRPAVERVWYEVLARVEFGRVKPLLVKKIRPFIVADSVAWSS LMSNISFTKSSSVLVPSEALTLDVKWLSFVVLLPSWHLSI


| Top |