Cherry SNP DataBase

Gene information

Gene Pav_sc0000893.1_g200.1.mk
Chromosome name PAV_r1.0chr1
start 25911181
end 25912812
PAV_r1.0 name Pav_sc0000893.1
start 101706
end 103337
direction +
Annotation NR PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like
Sequence CDS ATGAGAACTGAAACACAGGCACCCTACTCGACCCACGAAACCATGGCGGCCAACACCACC GTGATTGGCCAACAGGATTATGATAGAGCTCAACAAGTCAAGCAATTCGATCAATCCAAG CTCGGAGTCAAAGGCCTCGTTGACTCCGGCCTCACCTCCATCCCCCGTTTCTTTATCCAC CCGCCCGAAACACTAGCCGACCTCCGACCCCATACTAAACCCCAAACCCAGCAACAACCG ATCCCCACCATCGACCTCTCCGACCTTCACACCCATCGCCGCTCATCCATCGTCCAACCA ATCAGCTGCGCCTGCCGAACATTCGGTTTCTTCCAGATCACCAACCACGGCATCCCGTCT GCGGTTCTGGACCGTACGATTGCCGGCATCAAGGCCTTCCACGAGCAGCCGACGGAGGTC AAGGCGCCGTTCTACAGCAGAGAGATGGGCACGGGCGTATCTTATCTGTCCAACGTCGAC CTGTACAGCTCAAAAGCCGCCAGCTGGAGGGACACGCTTCAAGTAAGGCTGGGACCCATT CCAGCGGTTCCTGAAGAAGTGCCGGAGATTTGTCGGGACGAGATTGTTGGGTGGGACGTG GAGATCCGACGGCTGGGAGAGGCGCTGATGGAGTTGTTGAGTGAAGGGTTGGGATTGAAC GCGGGGAGGTTGAGGGAGATGACGTGTCTGGGAGGGAGGGTGATGGCGGCCCATTACTAC CCCTACTGCCCCCAGTCTGATCTGACGGTGGGGCTTACATCTCATTCTGACCCGGGAGTG TTGACCGTGGTACTTCAGGACCACATGGGTGGGTTGCAGGTTAAGCACGGTGAGGATTGG GTGGACGTGAAACCCGTCCCCGGCGCTCTTGTTATCAACGTTGGAGATTTACTTCAGATT ATGTCCAACGGGGAATACAAGAGTGTAGATCATCGGGTGTTGGCAAACTCAAACCGCGAG CCACGGGTGTCAACTGCAGTGTTTTTCAATCCAAGCAATAGAGAGGGCACCTATGGTCCA TTGCCAGAGCTGGTCGCACACGAGAAACCGCCACTTTACCGAGAGTTCACGTTTTCAGAG TTCATGCAAAGGTTCTTCAATAAAGGATTGGATGGCAAAGCTTTGGTCAATCACTTTGAG CTGTAA
PEP MRTETQAPYSTHETMAANTTVIGQQDYDRAQQVKQFDQSKLGVKGLVDSGLTSIPRFFIH PPETLADLRPHTKPQTQQQPIPTIDLSDLHTHRRSSIVQPISCACRTFGFFQITNHGIPS AVLDRTIAGIKAFHEQPTEVKAPFYSREMGTGVSYLSNVDLYSSKAASWRDTLQVRLGPI PAVPEEVPEICRDEIVGWDVEIRRLGEALMELLSEGLGLNAGRLREMTCLGGRVMAAHYY PYCPQSDLTVGLTSHSDPGVLTVVLQDHMGGLQVKHGEDWVDVKPVPGALVINVGDLLQI MSNGEYKSVDHRVLANSNREPRVSTAVFFNPSNREGTYGPLPELVAHEKPPLYREFTFSE FMQRFFNKGLDGKALVNHFEL


| Top |