Cherry SNP DataBase

Gene information

Gene Pav_sc0000893.1_g360.1.mk
Chromosome name PAV_r1.0chr1
start 25998397
end 26008281
PAV_r1.0 name Pav_sc0000893.1
start 188922
end 198806
direction -
Annotation NR PREDICTED: LOW QUALITY PROTEIN: nuclear pore complex protein Nup155
Sequence CDS ATGTCTTGGGAGGATGAAATCGTTATGCGCGATGTCACCAATGCGGGCCTCGTCGTGAGT GACCGCATTGGCCGAGAAGTCGCGTCTCAGCTTGATCTTGAAGAAGCCCTAGAAGCTTCC AGATACGCAAGTCACCCCTATTCTACTCATCCCAGAGAGTGGCCGCCTTTGGTTGAGGTG GTGGATACTTGGGAGTTGCCTCGGGTACTTATTGAAAGATATAATGCAGCTGGTGGGGAA GGAAATTCATTATGTGGGATATTTCCCGAGATTCGTAGGGCATGGGCATCGGTAGATAAT TCCTTGTTTCTCTGGCGTTTTGACAAGTGGGATGGACAATGTCCTGAATATAGTGGGGAG GATCAAGCTATTTGTGCTGTTGGCCTTGCTAAATCTAAACCTGGTGTTTTTGTTGAAGCT ATTCAGTATCTTTTGATTTTGGCAACACCTGTTGAGTTAATTCTTGTAGGAGTATGTTGC TCTGGAGGGGCTGATGGCACAGATCCATATGCAGAAGTCTCACTACAGCCATTGCCAGAA TATACAGTACCATCTGATGGGATCACCATGACATGTATCACGTGTACTGACAAGGGTCGT ATTTTCCTTGCTGGGCGTGATGGTCACATTTATGAGCTACATTATACTACTGGATCAGGC TGGCAAAAGCGTTGCCGAAAAGTTTGTCTGACTGCCGGTTTAGGAAGCGTTATTTCAAGA TGGGTAGTACCAAATCTTTTTAAGTTTGGAGCTGTTGACCCCATCATTGAAATGGTTTTT GATAATGAAAGACACATCTTGTATGCACGAACTGAAGAAATGAAACTTCAGGTGTTTATT GTGGGGCAAAATGCTGATGGGCCATTGAAAAAAGTGGCAGAAGAAAGGAATCTGATAAAT CAGAGGGATGCCCATTATGGGGGTAGACAATCAACTGGACCTAGAGGTCCAAATCGATCT ACAAAGTCATCTATAGTCTGCATTTCACCCTTGTCTACCCTGGAATCTAAGTCTCTACAC CTTGTTGCTGTTTTGTCCGATGGCAGAAGGATGTACCTTACCACTTCTCCATCTAGTGGA AATTTGGGTGGGTTTAATACCAACCATAAACCTAGCTGTTTAAAAGTTGTGACAACTAGG CCTTCTCCTCCACTAGGGGTTGGTGGTGGACTTGCCTTTGGAAGCATGTCTCTTGCCGGT AGACCTCAGAATGACGATCTCTCCCTAAAGGTTGAGGCAGCATATTATTCTGCTGGAACT CTTGTCCTTTCTGATTCATCTCCACCAACCATGGCTTCTCTTCTTCTTGTGAGCCGTGAT TCAAGCACACAATCAGCTGGGTCAAGTACTTCGGGGACAAGTTCAAGGAGTTCTCGGGCA TTACGGGAATCTGTATCTTCTTTACCAGTTGAAGGACGGATGCTTTTTGTAGCAGATGTT TTCCCCTCGCCTGATACTGCAACTACTGTACAGTCTCTGTATTCAGAAATTGAATATGGT GGTTATGAAGGCTCTGATGAGTCCTGTGAAAAGGTAACTGGAAAACTTTGGGCCAGAGGT GACCTTTCAATCCAACATATATTGCCAAGGAGACGAGTTGTTGTTTTCAGTACTATGGGC ATGATGGAAATAGTTTTCAATAGGCCTGTGGACATTCTGAGGAGGTTGTTTGAGACTAAC ATCACCAGGTCAATCGTAGAAGAATTCTTCAATCGTTTTGGAGCTGGTGAGGCAGCTGCG ATGTGTTTAATGCTAGCAGCTAGGATAGTCCATTCAGAAACTCTTATAAGTAATGTTGTT TCTCAGAAGGCAGCTGAAGCTTTTGAGGACCCAAGACTTGTCGGAATGCCACAACTTGAG GGCAGCAATGCATTATCAAACACTAGAACAGCTGCTGGGGGATTCAGCATGGGGCAGGTT GTTCAGGAGGCTGAGCCTGTGTTTTCAGGTGCACATGAAGGGCTCTGTCTGTGTTCTGCA AGGTTGCTATTCCCCATATGGGAACTTCCTGTTGTGGTTGTAAAAGGTGATTTAGGTTCT GCAGATGCAATGTCAGAAAATGGGTTAGTTGTATGCCGGCTCTCTCTTGAGGCTATGCAA GTGCTTGAAAACAAAATTCGCTCTCTAGAGAAGTTTCTGAAGTCCAGAAGGAACCAAAGG AGGGGACTTTATGGCTGTGTTGCTGGTTTAGGAGATGTGACTGGTTCTATCCTTTATGGA ATTGGTTCAGAATTAGGTGGTGGTGACCACAGCATGGTGAGAAACTTATTTGGTGCTTAC TCACGGAACACTGAGTCTAATGATGGTGGTATGTCTAATAAAAGGCAGAGATTACCATAT AGTCCCGCTGAATTGGCAGCCATGGAGGTGAGGGCAATGGAATGCATCAGGCAGTTGCTT CATAGATCCAGTGAAGCCCTGTTTCTGCTCCAGCTTCTTTCACAGCACCATGTAACACGT TTGGTTCAGGGGTTTGATGCTAATCTGCGACAGGCATTAGTTCAAATGACATTTCATCAG TTAGTTTGTTCCGAGGAGGGTGACCACCTCGCTACAAGGCTCATATCTGCTCTGATGGAG TCTGAAATGTCATTATTTTCATGTCATTCATTGCTCCAGTATTATACTGGTCCTGATGGC AGGGGGGCAGTAAATGATATTAGTGGGAGATTACGGGAAGGCTGTCCAAGCTATTATAAG GAGTCTGATTACAAGTTTTTTCTGGCTGTGGAGTGTCTTGAGAGAGCTGCTGTAATTCCA GATCCTGAGGAGAAGGAGAATCTTGCTAGAGAGGCCTTCAATTTTTTGAGTAAAGTTCCA GAATCTGCTGATTTACGAACTGTCTGCAAACGATTTGAGGATTTAAGGTTTTATGAAGCC GTAGTTCGCTTGCCTTTACAAAAGGCACAGGCTCTTGACCCCGCAGGTGATGCTTTTAAT GACCAAATTGATGCAGCAGTCCGACAGCATGCACGTGCTCAACGTGAACAGTGCTATGAG ATTGTCATCAGTGCATTGCGTTCTCTAAAAGGTGAGCCTTCACAAAGGGAGTTTGGTTCT CCTCTTAGGCCTGCTGCTATGCGATCTGCCCTTGATCTGGTCTCTCGGAACAAATATATA TCCCAGATTGTTCAGCTGGGCATCCAATCTCCTGACAGATTATTTCACGAGTACTTGTAC CGTGCTATGATTGATTTGGGCCTTGAGAATGAGTTGCTGGAGTATGGAGGTCCTGATTTG GTGCCTTTCCTACAAAGTGCTGGCCGTGAACCTATACAAGAGGTTCGGGCTGTTTCTGCG GTCACATCGGCCACTTCTCCAATTAGTTACTCAGGAACAGCCATCCCATCCAATCAAGCC AAATATTCTGATCTGTTGGCACGATATTATGTCTTGAAGAGGCAGCATCTGCTTGCAGCT CATGTATTACTAAGACTGGCAGAGAGGCGTTCAACCGATTCTGGGGATGTTCCTACTCTA GATCAAAGGTATCATTACCTAAGTAATGCAGTCCTACAGGCTAAAAATGCAAGTAACAGT GAAGGCCTGGTAGGTTCTACCAGAGGTGCGTATGATGATGGGTTGTTAGATTTGTTGGAA GGAAAACTTGCTGTCCTTCGTTTTCAGATAAAGATCAAGGAGGAACTTGAGGCTTCTGCT TCCAGGATAGAAGCTTTGCCTGGTGCATCTGAGCCTGTCCAAAGTGGAACTGTTCCAAAT AGCACTTTGAGTGGTGATGCCAATCTTGCAAATATTGCACGAGAAAAGGCCAAAGAGCTA TCATTAGATTTAAAGAGTATAACTCAGTTATACAATGAATATGCTCTTCCATTTGAACTT TGGGAGATGTGTCTAGAAATCCTATACTTTGCATACTATTCTGGTGATGCTGATAGTAGC GTTGTAAGAGATACTTGGGCCAGATTAATTGATCAAGCTCTTTCAAGGGGTGGCATTGCT GAAGCTTGTTCAGTATTGAAGAGAGTTGGTTCTCACATTTATCCTGGAGATGGAGCTGGG GTTGAATCTGTTGGAGATGAAGATGTGGCAAGGGCTCTTCTTGCTGCTTGCAAGGGTGCA ATTGAGCCCGTATTGAACACTTATGACCAATTGTTGACGAGTGGTGCTATTTTGCCATCA CCAAACCTTAGGTTACGCCTTCTACGATCAGTATTAGTTGTACTTCGAGAGTGGGCAATG TCTGTGTTTGCACAAAGAATGGGTACAAGTGCTACTGGAGCTTCTTTAATTCTAGGTGGA ACATTTTCACTGGAGCAAACATCAGGGATTAACCAAGGGGTTCGAGATAAGATCTCAAGT GCAGCAAACAGGTATATGACTGAGGTACGGAGGTTAGCCCTTCCACAGAGCCAGACTGAA GCTGTTTTCCATGGCTTTCGAGAACTCGAAGAGTCACTGATAAGTCCCTTTTCTTTTGAT CGTTTTTGA
PEP MSWEDEIVMRDVTNAGLVVSDRIGREVASQLDLEEALEASRYASHPYSTHPREWPPLVEV VDTWELPRVLIERYNAAGGEGNSLCGIFPEIRRAWASVDNSLFLWRFDKWDGQCPEYSGE DQAICAVGLAKSKPGVFVEAIQYLLILATPVELILVGVCCSGGADGTDPYAEVSLQPLPE YTVPSDGITMTCITCTDKGRIFLAGRDGHIYELHYTTGSGWQKRCRKVCLTAGLGSVISR WVVPNLFKFGAVDPIIEMVFDNERHILYARTEEMKLQVFIVGQNADGPLKKVAEERNLIN QRDAHYGGRQSTGPRGPNRSTKSSIVCISPLSTLESKSLHLVAVLSDGRRMYLTTSPSSG NLGGFNTNHKPSCLKVVTTRPSPPLGVGGGLAFGSMSLAGRPQNDDLSLKVEAAYYSAGT LVLSDSSPPTMASLLLVSRDSSTQSAGSSTSGTSSRSSRALRESVSSLPVEGRMLFVADV FPSPDTATTVQSLYSEIEYGGYEGSDESCEKVTGKLWARGDLSIQHILPRRRVVVFSTMG MMEIVFNRPVDILRRLFETNITRSIVEEFFNRFGAGEAAAMCLMLAARIVHSETLISNVV SQKAAEAFEDPRLVGMPQLEGSNALSNTRTAAGGFSMGQVVQEAEPVFSGAHEGLCLCSA RLLFPIWELPVVVVKGDLGSADAMSENGLVVCRLSLEAMQVLENKIRSLEKFLKSRRNQR RGLYGCVAGLGDVTGSILYGIGSELGGGDHSMVRNLFGAYSRNTESNDGGMSNKRQRLPY SPAELAAMEVRAMECIRQLLHRSSEALFLLQLLSQHHVTRLVQGFDANLRQALVQMTFHQ LVCSEEGDHLATRLISALMESEMSLFSCHSLLQYYTGPDGRGAVNDISGRLREGCPSYYK ESDYKFFLAVECLERAAVIPDPEEKENLAREAFNFLSKVPESADLRTVCKRFEDLRFYEA VVRLPLQKAQALDPAGDAFNDQIDAAVRQHARAQREQCYEIVISALRSLKGEPSQREFGS PLRPAAMRSALDLVSRNKYISQIVQLGIQSPDRLFHEYLYRAMIDLGLENELLEYGGPDL VPFLQSAGREPIQEVRAVSAVTSATSPISYSGTAIPSNQAKYSDLLARYYVLKRQHLLAA HVLLRLAERRSTDSGDVPTLDQRYHYLSNAVLQAKNASNSEGLVGSTRGAYDDGLLDLLE GKLAVLRFQIKIKEELEASASRIEALPGASEPVQSGTVPNSTLSGDANLANIAREKAKEL SLDLKSITQLYNEYALPFELWEMCLEILYFAYYSGDADSSVVRDTWARLIDQALSRGGIA EACSVLKRVGSHIYPGDGAGVESVGDEDVARALLAACKGAIEPVLNTYDQLLTSGAILPS PNLRLRLLRSVLVVLREWAMSVFAQRMGTSATGASLILGGTFSLEQTSGINQGVRDKISS AANRYMTEVRRLALPQSQTEAVFHGFRELEESLISPFSFDRF


| Top |