Cherry SNP DataBase

Gene information

Gene Pav_sc0000893.1_g480.1.mk
Chromosome name PAV_r1.0chr1
start 26074488
end 26088275
PAV_r1.0 name Pav_sc0000893.1
start 265013
end 278800
direction +
Annotation NR PREDICTED: probable RNA-dependent RNA polymerase 1
Sequence CDS ATGTCATTCTCAAGTGCGAGTGTTAGCATAATACCTTCCATTATTTACTTCGGAGAATTG GTTTTTCTTTCTGCTGTTATTAATATCAATTTGTACGTTGAATCTGCAGCAGTTGCCATC AACATTATGAAAATGGTTAAGACAATTCAATTGTATGGATTTTCCTCCAGCGAGTCTCCA GCAGCAGTGACAGAATTTCTGGAGGCATATACTGGAAAAGGAAGTGTTCATGCTATAAAG TTTCTTCCTCCCAAAGATGGAAATTCAAGAACACTTGCCATAGTTCAGTTCACAGATGCA AAATTTGCTGGTATCATAATTCCATTAGCCGATGCTCGAAGCCTGTGGTACAATAAATCT TATCTGAAAGCTAGAAAAGCAAAAGCACTGCAAGCACTTGAAATGATATTCCAAGGAGAG GTCACCGACGTTTTGAAGGAAATGCTTGCGTGTAGTTATAAGCCAGATGCAGAACCATTT CTGTCATTGATGCTACAAGCATTCTGTGCATCCAAGCTTGTGGAGTTGCGGACCAAGACG AGGATATTTGTATTTGTGCAGTGTTCTCAACGTGCCGTCTTCGGTGGCAATAGCAATAGC AGCGCTACTTCAAGCGAAGACACTTTCATTGTTGAGGAAAACGTAGTGGTTGCTAAAAAC CCCTGTTTACATCCAGGAGATGTTCGTGTTCTTAGGGCTGTGAACGTGCCGGCCTTGCAC CACATGGTGGACTGTGAGGTTACAGAGTCATTTACCAACTACATAGTGAACGACAACTTG GGGATCATTTGTAATGCACATACTGTCTTTGCAGACACAGAGCGACAGAAGGCTGCCAGT GCTCCATGTATCAAGCTCGCCGAGCTCAGCTCGCATGCTGTTGACTCTCCGAAAACTGGT GTGGTAGTGGAAGTGCCACGCTGTGTACGTATCCACAAATACCCAGATTTCATGGAGAAG GTTGACAAACCCACCTACGAGTCAAAACGTGTGATTGGGAGGCTTTTCCGACAGGTGAAA CATGTTGAGCTTGCATCAGATTCACCTTCAAACTCGGGCTCAATTAAATCCTTCACCATG GAAGTTGCTATGAAGTTTTATGACACTGATATGGTGGTAGATGGATTTGAAGACTACCTC AAAGATGCCATCAATTACAAAAGTGAGTATGACTACAAGCTGGGAAACCTGATGGATTAC TACGGCTACAAAACTGAAGCCGAAATACTAAGTGGGAGCATCACTGCAGTATCAAAAAAT TTCAGCAGGGAAAAAGACTTGGAGTCGATTCATTACGCTATAAAGGCATTGATAAAGGAA GCTAGGACCTGGTTTGATGAGAAGCTGGGAATGCAGTCGGATATGAAGCCTGATATTAAT GATGTACAAGCAGCAAAAGCATCAGCTTGGTACCATGTTACATATCATCCTGATTACTGG GGTTGCTGCAACAAGGGAATGGAAAGAGATCATTTCCTGAGCTTTCCATGGTGTGTGTTT GACAAGCTCATCCAGATCAAGAGGAGAAACTCTTCACTGAAGTGCATAAATACAGTGACT AAACTCACATGA
PEP MSFSSASVSIIPSIIYFGELVFLSAVININLYVESAAVAINIMKMVKTIQLYGFSSSESP AAVTEFLEAYTGKGSVHAIKFLPPKDGNSRTLAIVQFTDAKFAGIIIPLADARSLWYNKS YLKARKAKALQALEMIFQGEVTDVLKEMLACSYKPDAEPFLSLMLQAFCASKLVELRTKT RIFVFVQCSQRAVFGGNSNSSATSSEDTFIVEENVVVAKNPCLHPGDVRVLRAVNVPALH HMVDCEVTESFTNYIVNDNLGIICNAHTVFADTERQKAASAPCIKLAELSSHAVDSPKTG VVVEVPRCVRIHKYPDFMEKVDKPTYESKRVIGRLFRQVKHVELASDSPSNSGSIKSFTM EVAMKFYDTDMVVDGFEDYLKDAINYKSEYDYKLGNLMDYYGYKTEAEILSGSITAVSKN FSREKDLESIHYAIKALIKEARTWFDEKLGMQSDMKPDINDVQAAKASAWYHVTYHPDYW GCCNKGMERDHFLSFPWCVFDKLIQIKRRNSSLKCINTVTKLT


| Top |