Cherry SNP DataBase

Gene information

Gene Pav_sc0000893.1_g600.1.mk
Chromosome name PAV_r1.0chr1
start 26140762
end 26152078
PAV_r1.0 name Pav_sc0000893.1
start 331287
end 342603
direction -
Annotation NR PREDICTED: nucleolar protein 12
Sequence CDS ATGACAGCTCATTGCCTCCACACAAAGCTTCAGATCTGCAAATACGTCTACCATGATGTG GTTCGCCTTCAAGAAATTCAGAAGCATCTTGACTGTTCTAAAATTCAGACATATAAAATC AATGGTGAGAAAGCTGTGCATCTAAATCCTCGCCCTCTTGCCAAAGATGCCAAGCCATCA ACAAAAGCAAAGTTTGGTGCTTCCTGTGAAGCTTGTGGGAGATATCTGCAGGACATGCCA AATCGTTACTGCTCCATTGCCTGCAAGGCATCTATAGTCCCAGTGAAGCCTGAAGACCAA AGTCACAAATTCATCGCAGTTACTATACCACAATATGGTGATTTTTCATTAAAAGGTAAC TGCAATTCCGAAACAAACATGAGCGAAATGGAATCATCGATCTCGTTGGCTGAGTCGTCT GAGGAGATGACTGCTTGGACTCCGGTGGAACATGCAAATGAGGGGATTGAAGCAGTTCCC CAGTCAACAACTGCAACACCAAACTCCACAACCAATGTTTCAGATATAAGAACAGTCAAG GTTAGCAATGTCTCTCAAGCTGTTTCTGACAGGGATATCAAAGAATTCTTTTCATTCTCT GGAGATATACAATATGTTGAAATGCAAAGAGAAACTGAAAACACCCAGCTTGCCTATGTT ACCTTCAAGGATTCACAAGGAGCAGATACAGCAGTTCTCCTCTCGGGAGCCACCGTAGCT GATCTTTCTGTCACCATTACGCCAGTTGACGATTATAAGCTGCCGCCTGAAGCCATCCCA CTCCCATCAAGCCCGGAGAAAAAGCCTGCTGTGGCTAATTCTGCTGTAAGGAAGGCAGAA GATGTGGCCAGCGCTATGCTTGCCAAGGGTTACATCTTAGGAAAGGATGCCATTAACAAG GCAAAGGCCTTTGATGAGAGGCATCAACTAATGTCAAATGCCTCTGCCACAGTTGTTACA ATTGACCAGAAGATAGGTCTGATGGAGAAGCTAAGGGCTGGAACAGCTGTTGTCAATGAA AAGGTGAGAGAGATGGATCAAAGGTTCATGGTCTCGGAAAAGACCAAATCTGCCTTTGCT GTTGCTGAGCAGAAGGCAAGCATTGCAGGGTCTGCTCTCATGAGCAACCCTTACATATTG ACCGGAGCTTCGTGGGTTTCAAATGCAGTCAGTGCAGTTGCAAAGGTAGCTGAGGATGTG GGCATGATGACCAAGGAGAAGGTGGACAGGGCCGAGGAGGAGAAAAAGGAGATTGAACAC AGGCAGAGGACAGAGGTCATCACCGACTTTGCTCAGACCCATCTTGATGAGTCTTCTGGT AGGGTTCCTCCTGCAGTTTCAGCCAGTTATCCCAATGACACGAAGCTGGGAATTAAATGA
PEP MTAHCLHTKLQICKYVYHDVVRLQEIQKHLDCSKIQTYKINGEKAVHLNPRPLAKDAKPS TKAKFGASCEACGRYLQDMPNRYCSIACKASIVPVKPEDQSHKFIAVTIPQYGDFSLKGN CNSETNMSEMESSISLAESSEEMTAWTPVEHANEGIEAVPQSTTATPNSTTNVSDIRTVK VSNVSQAVSDRDIKEFFSFSGDIQYVEMQRETENTQLAYVTFKDSQGADTAVLLSGATVA DLSVTITPVDDYKLPPEAIPLPSSPEKKPAVANSAVRKAEDVASAMLAKGYILGKDAINK AKAFDERHQLMSNASATVVTIDQKIGLMEKLRAGTAVVNEKVREMDQRFMVSEKTKSAFA VAEQKASIAGSALMSNPYILTGASWVSNAVSAVAKVAEDVGMMTKEKVDRAEEEKKEIEH RQRTEVITDFAQTHLDESSGRVPPAVSASYPNDTKLGIK


| Top |