Cherry SNP DataBase

Gene information

Gene Pav_sc0000909.1_g330.1.mk
Chromosome name PAV_r1.0chr6
start 4079423
end 4083158
PAV_r1.0 name Pav_sc0000909.1
start 241304
end 245039
direction +
Annotation NR PREDICTED: NO-associated protein 1, chloroplastic/mitochondrial
Sequence CDS ATGCTATTGTTAGCTCGAAACCACTCCCTCTCAAAGCTAAAACCCCTCCTTTCTCTCTCT CTGATTTCCCATTCTTTCACAACCCAAACCCCATATTCTCATTTCACTTCAATCCCAAAA CCCCATTTCCAAAACCCCACAAATTCTCAACCTTTACCATTCTCAACCATCTTCTTCAAA CCCTTCTCGTCATCTAAATCGTTGCCCTTGAACCGTGAAGGAAATTACGATGAAGCCACC ACCCAAGCTCACCTCGTCTGCCCTGGTTGTGGCGTTCACTTGCAGGACTCTGACCCTAAA ACCCCTGGCTTCTTCCTCAAACCCTCAAAAAAGGATCCAAGGACTTATCGATTGGGTGCC CATCTCGAGCATGTTGCGCACGAGCCAGAATTCAACGATTCCCTCAAAAGGGGTCTCATA ATCGACCCCGAAAACCTGAGCCCTGAATCCAATTTGGTCGAACTCAAGCCGGAGAAACCG GTGGTCTGTGCACGGTGCCACTCTCTGAGGCATTACGGTAAAGTGAAGGATCCAACGGTG GAGAACTTGCTTCCCGATTTTGATTTTGATCATACGGTTGGGAGGAAGTTGGCATTAGCC TCTGGGACCCGATCAGTGGTGCTAATGGTGGTGGACGCTGCAGACTTTGATGGGTCGTTT CCCAAAAAGGTTGCCAAGTTGGTTTCGGATACAATCGAGGAGCATTCAGCAGCTTGGAAA CAGGGTAAGTCAGGGAATGTGCCAAGAGTGGTGCTTGTGGTAACAAAGATTGATCTTTTG CCAAGTTCATTGTCACCAACAAGGTTAGAGCATTGGGTTAGGACAAGAGCAAGGGAGGGC GGAGCCAATAAGTTAACAAGTGTGCATTTGGTGAGTGCTGTTAGGGATTGGGGGTTGAAA AATCTTGTTGATGATGTTGTTAGCTTGGCAGGACCAAGAGGGAATGTGTGGGCAATAGGC GCACAGAATGCAGGGAAGAGTACGTTGATAAATGCAATTGGGAAGCATGTTGGAGGGAAG ATTACGCATCTGACAGAAGCGCCTGTGCCCGGAACAACATTGGGAATTGTTAGAGTGGAA GGTGTACTTCCTGGTCATACCAAGTTATTTGATACGCCCGGGCTTTTGAATCCTCATCAG ATTACAACCAGATTGACAAGAGAAGAACAGAGTCTTGTAAACATTAGCAAGGAATTGAAA CCAAGAACATACAGGATCAAGGATGGTTATTCAGTTCATATCGCTGGGCTTATGAGGCTG GATATAGAAGAATCATCAGTAGATACTGTTTATGTTACAGCATGGGCATCTCCTTATCTT CCATTACACATGGGAAAAACAGAAAATGCATGCACAATGGTAGAGGAACATTTTGGTCTT CAATTACAGCCACCAATTGGAGAGACTAGAGTCAAGGAGCTTGGGAAGTGGGTGAGAAAG GAATTTCACATCAGTGGAAACAGTTGGGATTCAAGTTCGGTGGATATTGCTGCTGCAGGT CTTGGTTGGTTTGCTGTTGGACTTAAAGGAGAGGCAGTTTTGAGTGTTTGGACGTATGAT GGTATTGACGTTGTTCTTCGCAATGCATTGCTTCCTAATAGATCATACATTTTTGAAGTT GCTGGTTTTACAGTCTCTAAAATTGTCTCTAAGGCTGACCAAGCTTCAAATAAGCCACAC CACCGAAGTGAGAAGAAGAGGAAACAAAGTGACCGAAAGGAATCTGTTGCTTGCTGA
PEP MLLLARNHSLSKLKPLLSLSLISHSFTTQTPYSHFTSIPKPHFQNPTNSQPLPFSTIFFK PFSSSKSLPLNREGNYDEATTQAHLVCPGCGVHLQDSDPKTPGFFLKPSKKDPRTYRLGA HLEHVAHEPEFNDSLKRGLIIDPENLSPESNLVELKPEKPVVCARCHSLRHYGKVKDPTV ENLLPDFDFDHTVGRKLALASGTRSVVLMVVDAADFDGSFPKKVAKLVSDTIEEHSAAWK QGKSGNVPRVVLVVTKIDLLPSSLSPTRLEHWVRTRAREGGANKLTSVHLVSAVRDWGLK NLVDDVVSLAGPRGNVWAIGAQNAGKSTLINAIGKHVGGKITHLTEAPVPGTTLGIVRVE GVLPGHTKLFDTPGLLNPHQITTRLTREEQSLVNISKELKPRTYRIKDGYSVHIAGLMRL DIEESSVDTVYVTAWASPYLPLHMGKTENACTMVEEHFGLQLQPPIGETRVKELGKWVRK EFHISGNSWDSSSVDIAAAGLGWFAVGLKGEAVLSVWTYDGIDVVLRNALLPNRSYIFEV AGFTVSKIVSKADQASNKPHHRSEKKRKQSDRKESVAC


| Top |