Cherry SNP DataBase

Gene information

Gene Pav_sc0000910.1_g450.1.mk
Chromosome name PAV_r1.0chr4
start 1115241
end 1123631
PAV_r1.0 name Pav_sc0000910.1
start 241844
end 250234
direction +
Annotation NR PREDICTED: protein TRANSPARENT TESTA 12-like
Sequence CDS ATGGTCAATGATCAAGACCAACTCCGGCAACCCATCTTAGACTCCGAACCCAACACAACA GCACCCGAAGCCTCCAACCATGGCGATGGCTTGGAGTCTCCACTTGAGAAGGTGCTATCT GACACCCAACTGCCCTCCTTCAAGAGACTCCGCTTGGCCACATGGATTGAACTCAAGCTC CTCTTTCGCCTTGCAGCCCCTGCCGTCTTGGTTTATGTCGTTAACAACTCCATGTCACTT TCCACCCGTGTCTTCGCAGGCCACCTCGGCAACCTTGAGCTTGCCGCCGCCTCCCTTGGC AACAGCGGCGTCCAACTCTTCGCCTACGGCCTCATGCCACCAAAGCTAGCTGCAGCAGCC GCCGTTTTCGTCTACGGTCTCATCCCACAAATCTTTGCCTACGCCATCAACTTCCCGATA CAAAAGTTTCTTCAAGCCCAGAGAATTGTGGCCCCAAGCGCCTACATATCAGCCGCTACA CTTGGAGTGCATATACTGCTGAGCTGGGTAGCTGTTGTGAGGGTAAGCAATGAGCTAGGT GCTGGGAATCCAAAGTCAGCAGCATTCTCAGTTCTAGTGGTAACAATTGTGTCGTTAATG ATTGCTGTCGTGGAAGCTGTGGTTGTGCTCTCCTTCCGTGACGTCATCAGCTACGCCTTC ACCGACGGTGAAACCGTGGCCAATGCCGTGTCCCACCTCACTCCTTACTTGGCCATCACT CTTATCCTTAATGGGATTCAACCAGTCCTGTCCGGGGATCTGGTCGGGGATGATAGGAGG AACATTCATGCAGACTATCATCTTACTGTGGGTAACATTTCGTACGGACTGGAACAAAGA GACTCCGACCCCGACTCAGCAGCAGCCGAAGCCTCCGGCCATGGCAATGGCTTGGAGTCT CCACTTGAGAAGGTGCTATCTGACACCCAGCTGTCCTCCTTCAAGAGACTCCGCTTGGCC ACTTGGATTGAACTCAAGCTCCTCTTTCGCCTTGCAGCCCCCGCCGTATTGGTGTATGTC GTTAACAACATCATGTCACTTTCCACTCGTGTCTTCGCCGGCCACCTCGGCAACCTTGAG CTCGCCGCCGCCTCCCTTGGCAACAGCGGCGTCCAACTCTTCGCCTACGGCCTCATGACA CCAAAGCTGGCTGCAGCAGCCGCCGTTTATGTCTACGGCCTCATCCCACAAATCTTTGCC TACGCCATCAACTTCCCGATGCAAAAGTTTCTTCAAGCCCAGAGAATTGTGGCCCCAAGT GCCTACATATCAGCAGCTACACTTGGTGTGCATTTAGTGCTGAGCTGGGTGGCTGTGTAC AAGTTGGGCATGGGGTTGATAGGTGCGTCGTTGGTTCTGAGCTTGTCGTGGTGGGTCATA GTTGGGGCCCAGTTTATTTACATCCTAAAGAGCAGTCGGTGCAAGGAGACGTGGACTGGG TTTAGTTTGGAAGCGTTTTCTGGGTTGTGGGATTTTCTGAAGCTATCGGCTGCATCGGCT GTGATGCTGTGCTTGGAGACATGGTATTTTCAGGTATTAGTGTTGATTGCTGGGTTGCTC GAGAACCCTGAGCTCGCGTTAAATTCTTTGGCCGTATGTGTGAGGGTAAGCAATGAGCTA GGTGCTGGGAATCCAAAGTCAGCCGCATTCTCAGTTCTAGTGGTAACAATTGTGTCGCTA TTGATAGCTATCGTGGAAGCTGTGGTTGTGCTCTCCTTACGTCACGTCATCAGCTACGCC TTCACCGACGGTGAAACCGTGGCCAATGCAGTCTCCCACCTCACTCCTTACTTGGCCGTC ACCCTTATTCTTAACGGGATTCAACCAGTCCTGTCCGGGGATCTGGACGGGGATGATAGG AGGAACATTGATGCAGACCATCATCTTACTGTGGGTAACGTTTCGTACCGATTGGAATAA
PEP MVNDQDQLRQPILDSEPNTTAPEASNHGDGLESPLEKVLSDTQLPSFKRLRLATWIELKL LFRLAAPAVLVYVVNNSMSLSTRVFAGHLGNLELAAASLGNSGVQLFAYGLMPPKLAAAA AVFVYGLIPQIFAYAINFPIQKFLQAQRIVAPSAYISAATLGVHILLSWVAVVRVSNELG AGNPKSAAFSVLVVTIVSLMIAVVEAVVVLSFRDVISYAFTDGETVANAVSHLTPYLAIT LILNGIQPVLSGDLVGDDRRNIHADYHLTVGNISYGLEQRDSDPDSAAAEASGHGNGLES PLEKVLSDTQLSSFKRLRLATWIELKLLFRLAAPAVLVYVVNNIMSLSTRVFAGHLGNLE LAAASLGNSGVQLFAYGLMTPKLAAAAAVYVYGLIPQIFAYAINFPMQKFLQAQRIVAPS AYISAATLGVHLVLSWVAVYKLGMGLIGASLVLSLSWWVIVGAQFIYILKSSRCKETWTG FSLEAFSGLWDFLKLSAASAVMLCLETWYFQVLVLIAGLLENPELALNSLAVCVRVSNEL GAGNPKSAAFSVLVVTIVSLLIAIVEAVVVLSLRHVISYAFTDGETVANAVSHLTPYLAV TLILNGIQPVLSGDLDGDDRRNIDADHHLTVGNVSYRLE


| Top |