Cherry SNP DataBase

Gene information

Gene Pav_sc0000915.1_g120.1.br
Chromosome name PAV_r1.0chr3
start 9500986
end 9503811
PAV_r1.0 name Pav_sc0000915.1
start 29735
end 32560
direction +
Annotation NR PREDICTED: probable receptor-like protein kinase At1g67000
Sequence CDS ATGCATCCCCTACTGCTTCAATCGTTGTTTCCTTTGCTTTTGATCACTTCCTTTCTTTCG GTCAACGTTGAGTTAAGTCTAGGCCAGGACAATGAACAATACGCAAACTGCGGTGAGGAT ATTAACTGCGGTGGCGTTGGAGGCATCACGTACCCCTTCTGGGGAGTAAACCGAGCTAAT TACTGTGGTCTGCCAGGGTTCGGGGTCAAATGCGTAGACAACACCCCCATGATCAACATG TCGAATATCAACTACAGAATTCTTAAAATGAACTCTATTGCTTCGTCTGTTACGGTTGCT AGGCAGGACTATTGGAAAACTATCTGTCCTCTTACTTATGTCAACACCAACATCAACTTC TCTCTGTTTAGTTATACTTCTGAGGTTACAAACCTGACCTTTTACTACGGGTGCAATACA AGTGTCCCAGGGCTTACTTCTAGTTCCCAAGTTTGCAGTACGAACAAAGGTAACATCACT GTTTCGTATGTCACACAAAGTCCCCCAAGTGATCCAGTTGCTACTGGCGCCTGTAAAAAT GGGGTCATTGTTCCGGTTTTTACAACAGCTGTTGTGGCTCTAGAGGCCAATCAAATGACT ATTGGCGAAGTAGTAGATGGGGGATCTGAATTGGACTTGGAGATTGATGATGATCAATGT AACCGTTGTGTGGAATCAGGAGGGAAGTGTGGGCTTAACACTACTAATGGTGGATTCAGT TGCTTTTGCCATGATCAGGCCTATGCAACCATATGTAATACAACTTCACTCGGACGACAA GGTTCACGGAAAGAATTGGCCGTAGGCATTGCGGTTGCTGTTCCGTCGATCATCATAATC ATTTTTTTTACTATATGCATAACAAGGAAAAGAATATTGGCCTTCTTCAAGAAAGATAAA AGGGATGATGAGTTTGAATTTGATGTTGAGGCACGTATTAGGAACTATGGATCGTTTACT CCAAAGAGGTATAGTTATGCAAATGTCAAGAAAATGACAGACTCGTTCAAAGATAAAATA GGTAAAGGTGGATATGGAACCGTGTACAAAGGCAGGCTACCTGATGGCCTTCTCGTGGCG GTCAAAGTCCTAAGCGAGTCGAAGGGTAACGGGGAAGAATTTATTAATGAAGTTGCTAGC ATTGGTAGAACTTCCCATGTCAACATAGTCACTCTTTCTGGATTCTGTTATGAGAGGGAC AAAAGAGCTTTGATTTATGAGTTCATGCCTAATGGATCTCTGGATAATTTCATACATAAG CACGGTTCTGAAATGACAAATTGTCGCTTAGAATGGAAAACACTATCTGAAATTGCAGTT TGCATTGCACGAGGACTAGAATACTTACACCGTGGATGTAACACGAGAATTCTGCATTTT GACATAAAGCCACAGAACATTCTTTTGGATAAAGATTTTTGCCCAAAAATCTCTGATTTT GGCCTTGCCAAATTATGCGAAACAAAGGAGAGTATTGTATCGATGATAGGTGCGAGAGGA ACTGCAGGATACATAGCACCAGAAGTTTTTAGTCGGAGCTTTGGAGGCGTATCTCACAAA TCTGATGTGTACAGCTACGGGATGTTGATTCTTGAAATGGTTGGAGCAAGAAAGAATTTG GATTCGGGAGTGTCTCGTACGAGTGAAATATTCCCAAATTATGTTTATAAAGATCTAGAG CTACACAAGGCTGAACATATATTTGGGGATATATCTGAGGAGGAAAAAGAAGTAGCAAGA AAGATGGTATTAATAAGCCTGTGGTGCATTCAGACCATTCCTTCTGATCGGCCATCAATG ACCAAAGTTGTGGAGATGTTGGAAGGACCCCTTCATTCCTTGCAAATCGCACCCAAGCCT TTCTTGTTTTCTCCTACAATAGTTGCAGAAGACTCTGTCACCACATCCCAAACCATCTGA
PEP MHPLLLQSLFPLLLITSFLSVNVELSLGQDNEQYANCGEDINCGGVGGITYPFWGVNRAN YCGLPGFGVKCVDNTPMINMSNINYRILKMNSIASSVTVARQDYWKTICPLTYVNTNINF SLFSYTSEVTNLTFYYGCNTSVPGLTSSSQVCSTNKGNITVSYVTQSPPSDPVATGACKN GVIVPVFTTAVVALEANQMTIGEVVDGGSELDLEIDDDQCNRCVESGGKCGLNTTNGGFS CFCHDQAYATICNTTSLGRQGSRKELAVGIAVAVPSIIIIIFFTICITRKRILAFFKKDK RDDEFEFDVEARIRNYGSFTPKRYSYANVKKMTDSFKDKIGKGGYGTVYKGRLPDGLLVA VKVLSESKGNGEEFINEVASIGRTSHVNIVTLSGFCYERDKRALIYEFMPNGSLDNFIHK HGSEMTNCRLEWKTLSEIAVCIARGLEYLHRGCNTRILHFDIKPQNILLDKDFCPKISDF GLAKLCETKESIVSMIGARGTAGYIAPEVFSRSFGGVSHKSDVYSYGMLILEMVGARKNL DSGVSRTSEIFPNYVYKDLELHKAEHIFGDISEEEKEVARKMVLISLWCIQTIPSDRPSM TKVVEMLEGPLHSLQIAPKPFLFSPTIVAEDSVTTSQTI


| Top |