Cherry SNP DataBase

Gene information

Gene Pav_sc0000977.1_g030.1.br
Chromosome name PAV_r1.0chr6
start 9399362
end 9400189
PAV_r1.0 name Pav_sc0000977.1
start 9666
end 10493
direction -
Annotation NR PREDICTED: receptor-like protein 12
Sequence CDS ATGAGAATTCCTCTGTTTTCATGGCTTTTCTTAATCCTTATTTACTATGTTTCACTCAGC GTCCATGTATTTGTGGTCTCTAGCCAATGTCCCAGCGATCAGAAATCTTTGTTGCTTCAG TTGAAGAACAGCCTCAAATTTGACTCTACATCATCTAAAAAACTTGTGAAATGGAACAAT GGCTCAGATTACTGCTATTGGAAAGGTGTGTACTGTAAAGATGGCTGTGTTTCCCATCTC GACTTAAGCGGCGAGTCAATTTCAGGTGGACTTGATAATTCGAGTGCTCTTTTTGGTCTG CAGTACATTGAGAACCTGAATTTGGCTTACAATAACTTCGAATATACTCAGATTCCATCC AAGTTCGACAAGCTGACCGGTTTGAGTTATCTGAACCTGTCAAATGCTGGCTTTGTGGGG CAGATTCCAAGTGAGATTTCACACCTGACGAGGTTGGTAACTCTTGATTTATCTACCTTT TTTTACGTTCCCGGAACTCCTTCACTGCAACTTGAGAATCCAAATTTGAATGTACTCCTT GGCAACCTTTCTGAGCTTGTTGAACTTCATCTTGATGGTGTGAATATATCAGCACATGGG GCTCAGTGGTGCCAAGCTATATCATCTTCACTGCCAAAATTGAGGGTGTTGAGCTTGTCC GCTTCTAATATTTCAGGCCCTTTTGATAGTTCATTACTGAAACTTCACTCACTCTCAGTT ATTCGTATAGAGGAAATCAATTTGTCTACTCAAGTTCCAGAATTCTTCTCAAATTTCACA AATTTGACTTCCTTGCGCCTCAGCAATTCTGGGTTACATGGTATATAA
PEP MRIPLFSWLFLILIYYVSLSVHVFVVSSQCPSDQKSLLLQLKNSLKFDSTSSKKLVKWNN GSDYCYWKGVYCKDGCVSHLDLSGESISGGLDNSSALFGLQYIENLNLAYNNFEYTQIPS KFDKLTGLSYLNLSNAGFVGQIPSEISHLTRLVTLDLSTFFYVPGTPSLQLENPNLNVLL GNLSELVELHLDGVNISAHGAQWCQAISSSLPKLRVLSLSASNISGPFDSSLLKLHSLSV IRIEEINLSTQVPEFFSNFTNLTSLRLSNSGLHGI


| Top |