Cherry SNP DataBase

Gene information

Gene Pav_sc0000981.1_g230.1.mk
Chromosome name PAV_r1.0chr3
start 7248813
end 7252734
PAV_r1.0 name Pav_sc0000981.1
start 117351
end 121272
direction +
Annotation NR uncharacterized LOC103945360
Sequence CDS ATGGCCACTACAACATCTCTGCTTCCCAAATCCCCCTCACCATTTCTCACCAACACACCT TCATTCCCTTCAACCCATTTCACCAAGCTCTCATTTTTGAGCCCATCAGACCACCCCAAT TGCACAAAAAGGCAAAATCTTCACACACAAGCCAAAAAGAAGAACCCCTGGCGTGACCCT TTTGATGATGGAGAGGACCCAGACATGGGGTATGGCTCTCTTTTTGCAGAGGGGAAGCAG GAAGAGGATGACAGACCGCCTGAAAACCCGGATAATCCATACGGGTTCTTGAAGTTCCCA ATGGGGTATAGTGTGGAAATTGCATCATTGGCTTTGAAAGTGAGGGGGGATGTTAGGAGG TGTTGTTGTGTGGTTTCTGGTGGTGTATATGAGAACTTGCTGTTTTTTCCGGTTATCCAG CTTATCAAGGATCGGTACCCGGGTGTGCAAGTGGATGTAGTGGCGTCTGCCAGAGGGAAG CAAGCTTATGAGTTGAATAAGAATGTGAGATGGGCTGATGTCTATGATCCTGATGATCAT TTTCCTGAGCCTGCTGAGTACACTGACATGGTTGGACTTCTTAAGTTATACCACCATGTT TCAATGGAAAATGTGGTGCTCCAATATAGGTTGGGTATGCTTAGTAATAGGTATTATGAC ATGATCTTATCAACCAAGCTAGCAGGGATCGGACACGGAATATTCTTGTTCATGACAACA GCCCGAGAACGGGTGAGCTATATTTATCCAAATGTAAATGCTGCAGGAGCTGGATTGTTT CTATCTGAAACATTTACACCAAATAGCATGAATCTCTCTGAAGGCGGATATAACATGTAT CACCAGATGGTTGATTGGTTGGGTAGACCGGTGCGGGATGTGCCACGGCAACCTCTGCCC CCACTTAAAGTATCAATCTCAAAGAAGCTAAAGCAGGTTGTAGAGTCCAAATATCAGAAT GCAGGTGTAAATAAAGGAAAATATATTGTGATTCATGGGTTGGAATCGGATTCGAAAGCC TCAATGCAGTCTAAGGGGGATGCTGATAGCTTACTGCCCATCCAAGTGTGGGCTACAATA GCTCGTGGTATAAGGGAATTTAGGCCAGTTTTTGTCATTCCACATGAGAAAGAAAGGGAA AATGTGGAGGAAGTAGTGGGAGAAGATACCAGCATTGTGTTCATGACAACCCCTGGGCAG CTTGCTGCCCTTATCAATGACTCAGCTGGTGTAATAACTACTAACACTGCAGCTATCCAA CTTGCAAACGCACGCGAAAAACCCTGCATTGCATTATTCGGTTCTGAAGAGAAAGGGAAA CTATTTGTTCCCAACACAGAAGAGAAGAAGAATTGTGTTATTGTTTCATCCAAGACCAGA CAATTAAAGGATATCGACACTGAAGCTGTTAAACGCGCACTTCAAATTTTCAATGTGTCC TTAGCTCTAGTCTAA
PEP MATTTSLLPKSPSPFLTNTPSFPSTHFTKLSFLSPSDHPNCTKRQNLHTQAKKKNPWRDP FDDGEDPDMGYGSLFAEGKQEEDDRPPENPDNPYGFLKFPMGYSVEIASLALKVRGDVRR CCCVVSGGVYENLLFFPVIQLIKDRYPGVQVDVVASARGKQAYELNKNVRWADVYDPDDH FPEPAEYTDMVGLLKLYHHVSMENVVLQYRLGMLSNRYYDMILSTKLAGIGHGIFLFMTT ARERVSYIYPNVNAAGAGLFLSETFTPNSMNLSEGGYNMYHQMVDWLGRPVRDVPRQPLP PLKVSISKKLKQVVESKYQNAGVNKGKYIVIHGLESDSKASMQSKGDADSLLPIQVWATI ARGIREFRPVFVIPHEKERENVEEVVGEDTSIVFMTTPGQLAALINDSAGVITTNTAAIQ LANAREKPCIALFGSEEKGKLFVPNTEEKKNCVIVSSKTRQLKDIDTEAVKRALQIFNVS LALV


| Top |