Cherry SNP DataBase

Gene information

Gene Pav_sc0001003.1_g260.1.mk
Chromosome name PAV_r1.0chr4
start 8626230
end 8630134
PAV_r1.0 name Pav_sc0001003.1
start 143441
end 147345
direction -
Annotation NR PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1
Sequence CDS ATGGCTGCGGCAGCAACAAATATTGTTCTGCCATTTTTACTTGTTCTGTTCGTGCATCTT TCATTTGGTCTTGTGTTGTCTGAGGCAAAGCTTGATGGCAACACAACTTTAAGTGTGCTT TTGGAGGTGAAGAGGTCATTTGTGGAAGACCCAGAAAAAGTGTTGAATGCTTGGTCTGAA AGCAACCCAAATTTCTGTACTTGGAGAGGGGTGTCTTGTGGGCTTGACTCGGTTGATGGC TCAGTTCAAGTGGTGGGGCTCAACCTATCTGACTCGTCACTCACCGGGTCAATATCACCC TCACTCGGTAGTTTGCAAAACCTGCTCCACCTTGATCTCTCTTCTAACGGCCTCACGGGT CCCATCCCACCAGCCCTCTCTAACCTCTCTTCCTTGGAATCTTTGCTTCTCTTTTCAAAC CAATTCAGTGGGCCCATCCCCACTCAGCTTGGCTCGCTGGTGAGTCTCCGAGTCATGAGA ATCGGTGACAATGAACTCACTGGGCATATTCCCGCCTCATTTGGCAATCTTGTCAATTTG GTCACTCTTGGTTTGGCCTCATGCAGTCTCAACGGTCCAATACCACCCCAACTCGGCCGA CTCGGCCAACTCGAGAATTTAATCATGCAACTCAATCAACTCGAGGGACCAATTCCAGCC GAGTTGGGGAACTGTTCTAGCCTCACTGTCTTCACAGCTGCTCAAAACCATCTCAATGGA TCGGTCCCTGAGGAATTGGGTCTTCTCCAGAATCTTCAACAACTGAATTTGGGCAACAAT AGTCTCTCTGGGGAGATTCCGGGTCAACTCGGCAGACTGAGTCAACTCGGGTACCTGAAT TTGGTGGGAAACCAGCTCGAAGGTCCAATACCCAAGTCCTTAGCTAAACTGGGTAATCTT CAAACTCTTGATTTGTCCATGAATAAGCTCACAGGAGGAATTCCAGAGGAAATGGGCAAC ATGGCTCAACTGGTTTACTTGGTTTTATCAAACAACAATCTCTCTGGGGTCATACCAAGA ACTCTATGCTCCAACACAACCAGTTTGGAGCACTTGATGATATCAGATGCTGCAATTTTT GGTGAAATCCCAGTAGAACTGAGCCAGTGCCAAACAATGAAGCAACTTGATTTGTCCAAT AACTTGCTTAATGGGTCAATACCAGTTGAGCTTTATGAGTTGGGGGAGTTAACTGATCTC TTGCTCCACAACAACAGCTTGGTTGGTTCAATTTCTCCTTACTTGGGCAACCTCAGCAAC CTGCAGACACTTGTTCTGTATCACAACAACTTGCAGGGTCCTCTGCCAAGAGAGATGGGA ATGCTTGGGAAGCTTGAGATTTCGTATCTCTATGATAATCAGCTCTCTGGAGAAATCCCA ATTGAGATTGGCAATTGTTCAAGCTTGCAAATGATTGATTTCTTTGGAAACCGTTTCAGT GGGGAGATTCCAATCACCATTGGAAGGCTCAAGGATTTGAACTTTTTTCATATCAGACAG AATGAACTGGTGGGTGAGCTTCCCGCCACATTGGGCAACTGTCATCAACTTACTATTCTG GACTTGGCAGACAACCGTTTATCTGGTGGCATTCCTATAACATTTGGATCCCTCCAAGCA ATGGAACAGTTCATGCTCTACAACAATTCCCTTGAAGGTAATCTTCCTGATACATTAGCT AATATGGGAAATTTGACCAGAGTGAATCTGTCAAGAAACAAGTTGAATGGAAGCATTACT GCATTGTGTAGCTCAAGTTCATTTCTTTCTTTTGATGTGACTGACAATAAATTTGATCAT GAGATTCCTTCCCAGCTGGGAAACTCGCCCTCTCTTGAGAGGTTGAGATTAGGGAACAAT CAATTTACTGGTCCAATCCCAGAGACACTGGGAAACATCAGTGAACTATCACTGTTAGAT GTCTCAGGAAATTCACTCACTGGACCAATACCAGCTGAGCTTTCATCCTGCAAGAAACTG GCCCATATTGATTTGAATAACAACTTTCTTTCGGGTACCATTCCGCGGTGGCTTGGAGGT TTGCCTCAGTTGGGAGAGTTGAAGCTCTCCTCAAATCGATTCACTGGGCCTCCTCCCCAA GAATTGTTCAATTGTTCTAAACTGCTGGTGCTTTCTCTGAATGACAATTCTCTCAATGGA ACTCTCCCTGCTGAAATTGGTAACCTTGAATCCCTTAATGTCCTAAACCTCAACCATAAC CTATTTTCGGGATCAATCCCTCCAGCCATTGGTAAGCTAGGAAAGCTGTATGAGCTTCGG CTCTCACAGAACGGATTTGATGGTGACATACCCTTTGAGCTTGGACAACTCCAAAATCTT CAGAGCATTTTAGACCTCAGTTACAACAATCTGAGTGGTCAGATCCCAGCCTCTATTGGG ACACTGACAAAACTTGAAGCACTTGATCTATCGCACAATCAACTTGTCGGAGAAGTCCCT TCCCCAGTTGCTGGGATGATTAGTTTGGGAAAGCTTAATCTGTCTTACAACAATCTGCAA GGAAAATTGAGCAAGCAACTCTCACACTGGCCAGCTGAGGCCTTTGCAGGAAACTTGCAT CTATGTGGAAGCCCTCTTGGTAAATGCAGTGTCAGAAGGCAACAGTCAGGCCCGAGCGAA TCGGCAGTGGTAGTCATTGCTGCAATATGTACTTTATCTGCAATTGCTCTACTGATATTT GGAGCTGCTTCTCTCTTGAAACACAAGCAAGAAGTTTTTAGAAAAGCCAGTGAAGTGAAC TGCTTGTACTCATCCAGCTCTTCCCATGCTCAGCGAAGACTGCTCTTCCCAAATGGTTCT GTCAAGCCAGATTTCAAATGGAAAGATATTATGGAAGCCACAAAAAATCTCAGTAATGAG TTCGTAATTGGCTCAGGAGGGTCAGGGATAATCTACAAAGCTGAGTTGTCCATGGGAGAA ACTGTGGCAGATTCTAAGCGTGATGAGTTGATAGACTCTGCACTGAAACCACTCATATCT GGAGAAGAATGTGCGGTATTCCAAGTGCTTGAAATAGCACTGCAGTGCACAAAAACCAGC CCAGCAGAGAGGCCTTCGTCCCGGCAAGCATGTGAACAACTATTACATGTTTTTAATCAT AGGATGGCGGAGTTTGAGAAGACGAATATAGATTCTTATACTACATAA
PEP MAAAATNIVLPFLLVLFVHLSFGLVLSEAKLDGNTTLSVLLEVKRSFVEDPEKVLNAWSE SNPNFCTWRGVSCGLDSVDGSVQVVGLNLSDSSLTGSISPSLGSLQNLLHLDLSSNGLTG PIPPALSNLSSLESLLLFSNQFSGPIPTQLGSLVSLRVMRIGDNELTGHIPASFGNLVNL VTLGLASCSLNGPIPPQLGRLGQLENLIMQLNQLEGPIPAELGNCSSLTVFTAAQNHLNG SVPEELGLLQNLQQLNLGNNSLSGEIPGQLGRLSQLGYLNLVGNQLEGPIPKSLAKLGNL QTLDLSMNKLTGGIPEEMGNMAQLVYLVLSNNNLSGVIPRTLCSNTTSLEHLMISDAAIF GEIPVELSQCQTMKQLDLSNNLLNGSIPVELYELGELTDLLLHNNSLVGSISPYLGNLSN LQTLVLYHNNLQGPLPREMGMLGKLEISYLYDNQLSGEIPIEIGNCSSLQMIDFFGNRFS GEIPITIGRLKDLNFFHIRQNELVGELPATLGNCHQLTILDLADNRLSGGIPITFGSLQA MEQFMLYNNSLEGNLPDTLANMGNLTRVNLSRNKLNGSITALCSSSSFLSFDVTDNKFDH EIPSQLGNSPSLERLRLGNNQFTGPIPETLGNISELSLLDVSGNSLTGPIPAELSSCKKL AHIDLNNNFLSGTIPRWLGGLPQLGELKLSSNRFTGPPPQELFNCSKLLVLSLNDNSLNG TLPAEIGNLESLNVLNLNHNLFSGSIPPAIGKLGKLYELRLSQNGFDGDIPFELGQLQNL QSILDLSYNNLSGQIPASIGTLTKLEALDLSHNQLVGEVPSPVAGMISLGKLNLSYNNLQ GKLSKQLSHWPAEAFAGNLHLCGSPLGKCSVRRQQSGPSESAVVVIAAICTLSAIALLIF GAASLLKHKQEVFRKASEVNCLYSSSSSHAQRRLLFPNGSVKPDFKWKDIMEATKNLSNE FVIGSGGSGIIYKAELSMGETVADSKRDELIDSALKPLISGEECAVFQVLEIALQCTKTS PAERPSSRQACEQLLHVFNHRMAEFEKTNIDSYTT


| Top |