Cherry SNP DataBase

Gene information

Gene Pav_sc0001020.1_g230.1.mk
Chromosome name PAV_r1.0chr7
start 9016354
end 9019896
PAV_r1.0 name Pav_sc0001020.1
start 176145
end 179687
direction +
Annotation NR PREDICTED: 60S ribosomal protein L21-1-like
Sequence CDS ATGCCGGCTGGACACGGTCTCAGGTCTCGTACTCGCGATCTCTTCTCGCGGGCCTTCAGG AAGAAGGGTTACATCCCTCTCTCAACCTATCTGAAGACCTACAGGATCGGCGACTATGTC GACGTCAAGGTTAACGGCGCCGTGCACAAGGGTATGCCCCACAAGTTCTACCATGGACGT ACTGGCCGCGTCTGGAACGTCACCAAGCGCGCCATCGGTGTGGAGATCAACAAGCAGGCA AAGGATGAGGTTATTAGCACCAAGAGGCAGCCGAAGGGACCCAAGCCAGGTTTCAGGGTT GAAGGAGCAGTCATGGAAACTGTTACTCCCATTCCATATGATGTCCACTTGGCTGGCTTA AAGCTGTGGCTGGTTGAATTCGGCACTTGCTCAGTGGTTCACGGCGATGCACTTGCCGTG AGGATCCCGGAGCACTGGTGCAATAAGCTGATTGATCAATCAAGCAGATGCGAGCTGCAG AGTTGCATTAAGGAATGCTCCAAAGACCCATCTGGTGTGGGAGTGTGCCAAAATACAGTT TGTTTTAGCACATACTATTGTAAGGATCCTCCAAAGTGA
PEP MPAGHGLRSRTRDLFSRAFRKKGYIPLSTYLKTYRIGDYVDVKVNGAVHKGMPHKFYHGR TGRVWNVTKRAIGVEINKQAKDEVISTKRQPKGPKPGFRVEGAVMETVTPIPYDVHLAGL KLWLVEFGTCSVVHGDALAVRIPEHWCNKLIDQSSRCELQSCIKECSKDPSGVGVCQNTV CFSTYYCKDPPK


| Top |