Cherry SNP DataBase

Gene information

Gene Pav_sc0001025.1_g830.1.mk
Chromosome name PAV_r1.0chr8
start 2793024
end 2795934
PAV_r1.0 name Pav_sc0001025.1
start 387583
end 390493
direction +
Annotation NR PREDICTED: urease accessory protein F
Sequence CDS ATGTCTTCTGCTGCTGCTGCTGCTGCTGCTTCTTCTTCTTCTTCTTCTTCATCTTCATGC GCAGTTTCATTTTTTCCACAGGAGGAGGAGATGGAGTTAAACAAAGAAAACAAGAAACGT CCTTCATCAGACTCTCTTGTACAGCAAAGTCAATGGCAACTGCACAATTCTGACCCCCCA ACAGTTGCCTTTGCTCGTTCTATGGATCTAAATAGAGAAAACAAGAAACGTGCTATATCA GACTCATTTTTACAGTGGAGCCAATGGCAACTGCTCGATTCTATCCTTCCAACAGGTGGT TTTGCTCACTCTTTTGGTCTCGAGGCAGCAATCCAAGCTCGTATAGTCTCTTGTCCTGAA GATCTCCAAACTTTTGTAATCCATCTGTTGGAGAATACTGGAAGCTTACTCCTTCCTTTT GTCTATTCTACAACAATGTCGCCTGATTTTGAGAACAGGCGCAAACTCGACAAAATGTTG GATGCAATGTTAACTAATGAAGTGAGTAGGAAGGCATCAATTTCACAAGGGTCGGCATTG ATGAGGGTGGCTGCATCCGTGTACTCGGAAATACCATCTCTTAAATCTATGAGGGAAGCT TCTTTAAGTTCTGGGGTTGTTTCTTTTCACCATGCCCCTATGTTTGGGGTTATATGTGGT CTGCTCGGGTTGGACAGCGCTACTTCTCAAAGAGCTTACATGTTTATTACAATGAGAGAT GTTATTTCTGCTGCAACAAGGCTCAATTTGGTAGGGCCCCTTGGTGCGGCTGTACTGCAG CATAAGATTGCTTCTGTTGCTGAAGCTATACTGAATCGATGGAAGGACCGTCCAGTTGAG GAAGCATGCCAAACTGTTGCTTTGCTTGACATTGTGCAAGGTTGCCATGGCTACCTGTTT TCTAGACTGTTCTGTTCTTGA
PEP MSSAAAAAAASSSSSSSSSCAVSFFPQEEEMELNKENKKRPSSDSLVQQSQWQLHNSDPP TVAFARSMDLNRENKKRAISDSFLQWSQWQLLDSILPTGGFAHSFGLEAAIQARIVSCPE DLQTFVIHLLENTGSLLLPFVYSTTMSPDFENRRKLDKMLDAMLTNEVSRKASISQGSAL MRVAASVYSEIPSLKSMREASLSSGVVSFHHAPMFGVICGLLGLDSATSQRAYMFITMRD VISAATRLNLVGPLGAAVLQHKIASVAEAILNRWKDRPVEEACQTVALLDIVQGCHGYLF SRLFCS


| Top |