Cherry SNP DataBase

Gene information

Gene Pav_sc0001030.1_g050.1.mk
Chromosome name PAV_r1.0chr1
start 27317822
end 27335785
PAV_r1.0 name Pav_sc0001030.1
start 21557
end 39520
direction +
Annotation NR PREDICTED: cleavage stimulation factor subunit 3
Sequence CDS ATGTCTCGTAATCCTTATAAATCTGCAAAGGAATCTAAAATCTGTTTAGTTATCTCATTG TCTTTCCCATGTTTTGAAAATAGTGTTCTGTATTTAGCTGATTTCCCTTCTCTCCAGGCA AAATATTGGAAGCAATATGTGGAGGCGCAGATGGTTGTAAATAATGATGAGGCCACAAAA CAGATATTTAGCCGGTCTTCTAATATCATCATGATGCAGGATGATGAAAACCAAACCACC CCTCCTCCATCACACCCGTCCGCCACCCCAACAGCCATCACCTTCCCCTACCCGGGAGCA CCGTTGTGGTGGCTCCTCATTCTTGGGATGCGAAGGAAAATAGTGAAAGATTGGAGCAAA GTGGAAGCAAACCATAATTTTGTGGCTGCTTGGGAGCATATTCACGTTCTTTTGAGGGCT GGAAGTTGGGGGCGATGCTACATTCGTTTCATCAGAAAGGTGAATGACAAGAAGGGGGTA GAGGGTCAGGAAGAGACTAGAAAAGCTTTTGATTTTATGCTTAGTTATGTTGGAGCAGAT ATAGCATCTGGGCCTGTGTGGATGGAGTACATCACCTTTTTAAAGTCTTTGCCGGCTTTA AGCACACAGGAAGAGTCACAACGCATGATTGCTGTGCGGAAAGTATACCAGAAAGCCATT GTTACTCCTACCCATCACATTGAACAACTTTGGAAGGAATATGAAAATTTTGAAAATTCT GTCAGCCGTCAACTGGCAAAAGGACTGTTATCTGAATATCAACCCAAATTTAACAGTGCC AGGGCCGTCTACAGGGAGCGGAAGAAGTACGTTGATGGAATTGACTGGAATATGCTTGCT GTACCACCAACTGGCTCTTACAAGGCAATTTTGCTTCTTATTGAAGAATTGCAGTGGATG GCATGGAAGAAGTTGTTAGCTTTTGAAAAAGGAAATCCACAAAGGATAGACAATGGATCA TCCAACAAGCGAATTATTTTCACTTATGAGCAGTGTCTAATGTATCTATACCATTATCCT GATTTGTGGTATGACTATGCCATGTGGCATGCAAAAAGTGGTTCAATAGATGCTGCAATT AAAGTTTTCCAGAGATCTTTGAAGGCAAGACCTGATGGTGTTAACACAACAGCACTTGCT CATATACAGTTCATTCGTTTCTTAAGGAGAACTGAAGGAGTTGAAGCAGCTCGCAAGTAC TTTTTAGATGCTCGCAAATCTCCAAATTGCACGTACCATGTTTATGTTGCTTATGCAATG ATGGCTTTCTGTCTTGACAAGGATCCAAAGATGGCACACAATGTTTTTGAAGCTGGGTTG AAACGGTTTATGCATGAGCCTGTGTACATTCTTGAGTCCCCCACATCTGGATCCTATTCA TGCTTGTGGGATGTGGCCCTACTCTTTGTGCTGAGACGCAACTTTGTGATATTTTATCCC AACTAG
PEP MSRNPYKSAKESKICLVISLSFPCFENSVLYLADFPSLQAKYWKQYVEAQMVVNNDEATK QIFSRSSNIIMMQDDENQTTPPPSHPSATPTAITFPYPGAPLWWLLILGMRRKIVKDWSK VEANHNFVAAWEHIHVLLRAGSWGRCYIRFIRKVNDKKGVEGQEETRKAFDFMLSYVGAD IASGPVWMEYITFLKSLPALSTQEESQRMIAVRKVYQKAIVTPTHHIEQLWKEYENFENS VSRQLAKGLLSEYQPKFNSARAVYRERKKYVDGIDWNMLAVPPTGSYKAILLLIEELQWM AWKKLLAFEKGNPQRIDNGSSNKRIIFTYEQCLMYLYHYPDLWYDYAMWHAKSGSIDAAI KVFQRSLKARPDGVNTTALAHIQFIRFLRRTEGVEAARKYFLDARKSPNCTYHVYVAYAM MAFCLDKDPKMAHNVFEAGLKRFMHEPVYILESPTSGSYSCLWDVALLFVLRRNFVIFYP N


| Top |