Cherry SNP DataBase

Gene information

Gene Pav_sc0001030.1_g270.1.mk
Chromosome name PAV_r1.0chr1
start 27189015
end 27192349
PAV_r1.0 name Pav_sc0001030.1
start 164993
end 168327
direction -
Annotation NR PREDICTED: G patch domain-containing protein 8 isoform X1
Sequence CDS ATGGGAGAGGACGAGCCGGTGACGGTGGGCTCATCTTCTTCAGGCATAGACTCCTCCAAT ATTGGGTTTCAGCTTTTGAAGAAGCAGGGCTGGACACAAGGAACGGGTCTTGGTGCTTCC CAGCAGGGTAGGCTAGAGCCTGTTAAAGCTTACTTGAAGGACAACAAACGAGGCTTAGGA GCAGATACATCAAGAAATAAATTCTTTCCGGTTTCTGAAAATTCAGATTCTAGTGGAAAC TATGAAAAGAACAATAGCTCCGTGCATTTGGTTCAGGAGGAAGAAGGTATGGGAAAAGGC ATGGTGGCTTCAAGTTGTTCAGCAATAGCCATCAATCCCTCCAATATAGGCTTTCAGCTT TTGAAGAAACATGGTTGGAAAGAAGGAACTGGTCTTGGGATTTCTGAGCAGGGAAGGATA GAGCCTGTACAAGCATACTTGAAGAATAATAAACGGGGCCTGGGAGCAGATAAATTACAG AAGGCACTAAATCCCCCTGATTCTACTGCCTTGAATCGAAAAAATGACCAGGAGCTGCAT TCAAAAAAAGGCAAGGGACTCTCAAAGAAGATGAAGAAAGAGCAGGAGTTAGAGAAAAGA TTGCAGGAGAGGGAATTTGAGCGTGCCTTTTATAGGGAGTTTTGGCCGGATAACGTTTGA
PEP MGEDEPVTVGSSSSGIDSSNIGFQLLKKQGWTQGTGLGASQQGRLEPVKAYLKDNKRGLG ADTSRNKFFPVSENSDSSGNYEKNNSSVHLVQEEEGMGKGMVASSCSAIAINPSNIGFQL LKKHGWKEGTGLGISEQGRIEPVQAYLKNNKRGLGADKLQKALNPPDSTALNRKNDQELH SKKGKGLSKKMKKEQELEKRLQEREFERAFYREFWPDNV


| Top |