Cherry SNP DataBase

Gene information

Gene Pav_sc0001031.1_g060.1.mk
Chromosome name PAV_r1.0chr1
start 7777970
end 7782742
PAV_r1.0 name Pav_sc0001031.1
start 31171
end 35943
direction -
Annotation NR PREDICTED: dihydrolipoyl dehydrogenase 1, chloroplastic-like
Sequence CDS ATGCAGGCATCGCTCTCTCTCCCTACCCTCTCTCCCACCATTCCCAGATCAAACTACGTC GTTCAATCAAAGCCTATCAATCTCCGCTTCTGCGGCCTCAGAAGAGAGGCCTTCGGCTTC TCGTCTCTCAGCCACTCCGATTCGCACCGAGTACGAGTCTCTGCTCCTTGGCGCTCTGCA ACCGTCTCGGTCTCGGCCTCGTCATCCGCTAATGGAAGCCCTCCCAAGTCGTTCGACTAC GACTTGCTCATCATCGGCGCGGGCGTCGGTGGCCACGGTGCTGCTCTCCACGCCGTCGAG AAGGGTCTGAAAACTGCCATCGTAGAAGGAGATGTGGTGGGTGGAACATGTGTTAACAGA GGATGCGTTCCATCTAAAGCTCTTTTGGCAGTGAGTGGTCGGATGCGTGAGCTTCAGAAT GAACATCACCTTAAGGCTTTAGGTTTGCAGGTTTCAGCAGCTGGGTATGACAGACAGGGA GTAGCTGATCATGCGAATAATCTTGCAACGAAAATTCGTAATAGTTTGACCAATTCAATG AATTCTCTTGGAGTGGATATACTGACAGGTGTTGGTACAATTCTGGGCCCTCAAAAGGTG CAAATTGGATCATCTGACAAAGTAGTAACTGCAAAAAATATAATCATCGCCACTGGTTCT GTTCCTTTTGTTCCTAAGGGTGTTGAAGTCGATGGGAAGACTGTAATTACAAGCGACCAT GCCCTCAAATTGGAGTTTGTTCCAGAGTGGATTGCTATTGTTGGGAGTGGTTACATTGGT CTCGAGTTCAGTGATGTGTACACTGCACTTGGGAGTGAGGTTACTTTTATTGAAGCTTTA GATCAGCTTATGCCTGGTTTTGATCCAGAGATCGGGAAGTTAGCCCAGAGGGTTCTAATA AATCCACGAAAGATTGATTATCAAACTGGAGTGTTTGCATCCAAGATCACACCAGCAAAG GATGGGAAACCAGTCACCATTGAATTAATTGATGCCAAGACCAAGGAACCAAAAGATACT CTTGAGGTAGATGCAGCATTAATTGCAACTGGAAGGGCCCCATTCACACAAGGTCTTGGA TTGGAGAATATTGATGTAGTAACACAACGTGGTTTTATTCCTGTTGATGAGCGCATGCGA GTAATAGATGCAAATGGCAACTTGCCTCAAGCAAGGGAGAAAGCTGAAAAGGAGGGATTT GAAGTAAGTATTGCCAAGACAAGTTTCAAGGCCAACACAAAGGCCCTAGCAGAAAATGAA GGAGAGGGACTTGCTAAGTTGATATACAGACCAGATAACGGAGAGATACTTGGAGTCCAT ATATTTGGGTTACATGCTGCAGACCTCATACATGAAGCATCAAATGCAATAGCATTGGGG ACACGTATTCAAGATATCAAATTCGCAGTCCATGCACATCCAACTTTGTCTGAAGTGCTA GATGAACTTTTCAAGTCAGCAAAGGTTAAAGAGCATGTTTCTAGCCCATTAAGTGAACCA GTTGCAGTCTAA
PEP MQASLSLPTLSPTIPRSNYVVQSKPINLRFCGLRREAFGFSSLSHSDSHRVRVSAPWRSA TVSVSASSSANGSPPKSFDYDLLIIGAGVGGHGAALHAVEKGLKTAIVEGDVVGGTCVNR GCVPSKALLAVSGRMRELQNEHHLKALGLQVSAAGYDRQGVADHANNLATKIRNSLTNSM NSLGVDILTGVGTILGPQKVQIGSSDKVVTAKNIIIATGSVPFVPKGVEVDGKTVITSDH ALKLEFVPEWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKLAQRVLI NPRKIDYQTGVFASKITPAKDGKPVTIELIDAKTKEPKDTLEVDAALIATGRAPFTQGLG LENIDVVTQRGFIPVDERMRVIDANGNLPQAREKAEKEGFEVSIAKTSFKANTKALAENE GEGLAKLIYRPDNGEILGVHIFGLHAADLIHEASNAIALGTRIQDIKFAVHAHPTLSEVL DELFKSAKVKEHVSSPLSEPVAV


| Top |