Cherry SNP DataBase

Gene information

Gene Pav_sc0001040.1_g210.1.br
Chromosome name PAV_r1.0chr2
start 6314821
end 6316477
PAV_r1.0 name Pav_sc0001040.1
start 86538
end 88194
direction -
Annotation NR
Sequence CDS ATGGCGGCCAAGGCTGGAGTTGGGGAAGAGTGTTGTGTTAGACCAGTTCCACCGCTCTAC CCTTTATCCGAGCAAGCTTTGGTTGGTGCCGTCGCTATGAAGGCTCCTGGTATGGTTTAC GTCCTCGCTACAGAGCTATATGCAATCAAAATGGGGATTTCCTTTGCGTTGGATGCTTAT CTGGTACCCTCAGTTGTAGACACTGATTGCCTAAATACAGTCCAAATGGTGAATGTCTAG
PEP MAAKAGVGEECCVRPVPPLYPLSEQALVGAVAMKAPGMVYVLATELYAIKMGISFALDAY LVPSVVDTDCLNTVQMVNV


| Top |