Cherry SNP DataBase

Gene information

Gene Pav_sc0001077.1_g150.1.mk
Chromosome name PAV_r1.0chr3
start 15781370
end 15783166
PAV_r1.0 name Pav_sc0001077.1
start 93297
end 95093
direction +
Annotation NR PREDICTED: 5'-adenylylsulfate reductase 1, chloroplastic-like
Sequence CDS ATGGTTTCCCTGTCCAAGATCTTGTACCCGAATTCTGGTAGCGTTCTATTTGATGAGGAC ATGAATGTGGCTTCATTTCAAGGCTTGTATGGTGCAATTGGCAGCCTAGTGATCATGGCA TGGAACCGAAAAGCAAACATAGGTAGCCAAGAAATGCATCAATATTTGAACTTCCTTCAC GTAGTTCAAGCCATGGATGTGCCTGCAGTTAGCTTGCATTATTGTTCTCGGGAACTTATC TCGACTGCAACATTCAAGCCATGCAATATTATGCTCCTCTTGTTCTGTCAGCGTGAATGG GAAGGGCGGTGGCTGCGGAGGTGGTGGTTGGAGGAGGTAATTAAGGTCAAGGAGTGTGGG CTAAAAACAGGAGATGTCAGGTTGGAGAACCCATGTGCACCATGGCTTGTTGTGCTCTTT AATATTTGGTGCCACATTTGCCAGGCTTTGGCTGAAGGACAGAAGGCAGCACTTCTGATG GTGAGCACATGCGAAGCAAGAGTTGCAGCTTGGATTCTATTCTCAGCAGCTTTTCGTCGA ACACCACACCTGCATACCCATCAAGCACTCTTCCGAAAGGGTCCACGCCGATAA
PEP MVSLSKILYPNSGSVLFDEDMNVASFQGLYGAIGSLVIMAWNRKANIGSQEMHQYLNFLH VVQAMDVPAVSLHYCSRELISTATFKPCNIMLLLFCQREWEGRWLRRWWLEEVIKVKECG LKTGDVRLENPCAPWLVVLFNIWCHICQALAEGQKAALLMVSTCEARVAAWILFSAAFRR TPHLHTHQALFRKGPRR


| Top |