Cherry SNP DataBase

Gene information

Gene Pav_sc0001082.1_g130.1.mk
Chromosome name PAV_r1.0chr1
start 10291701
end 10293411
PAV_r1.0 name Pav_sc0001082.1
start 78878
end 80588
direction +
Annotation NR PREDICTED: F-box/kelch-repeat protein At1g57790-like
Sequence CDS ATGTCAGTCGTTACTGATAAAAGGCTCAGGAGAGGAAGCCCGCCATGGTCTGATCTTCCA CATGACATATTGTGTTGCATAATGGGGCACCTTTGCTATGTGGACCAAATTCAATTTCGT GCTGTTTGCAAGAATTTTGGACTGGTTGCTGGTATTAGGCCTAAAGATAAACTGCCCTGG GTTCTAACATTAAACTTCAGTTTTAAAAATGATATGTACCCATCTAGCCTCTATGATCCA TGTACCCTTGAAGCATATAAGCTTGATCATGAACTAACATCTTCTAGCTGGACTGGGGTT GTCAAACTACAAGTTTGCGGTGCAAGAAATGGTTGGTTGCTTCTAGCTGAAATTACACCA TTTTTTTTCTTTGGTCACACTGATTTTTACCTCTACAATCCTTTCACTGATGATGCGAGT ATCAATTTGCCCCGTTTAAGAACCAAGGAATTTAAAGCCACTTTCACCTCCAATCTGACG TCCCCAGATTGTTTGTTTTTTGCCATACATGCTGATGAGGAAAGGGAAAAGGTAATGTGC ATAAGCACCTGCAGCCTTGGTGATAGAAAATGGACTGAGTCTCTAGCTGTTGAAGGTAAT TTGAAGCAAGTAATTGGTGTGGTCTATATCAAGGGCATCTTTTATTGTATTTTCAAAACT GGAATGCTAGGTTCCTTCAACCCTGCTACCAAAAAGTGGAGTCTGCTTATTTCAGAAAAC ACGAATTCATCGGAGTTACGAAGCCTTGCAGACTCATTTGAAGCTAGATTTGTTGAGTCC GATGGAGAGGTGTTACTGGTATACTCTAAGCGGAGCTATAAGCCTTGGCACATTTTCAGG CTAGACTGGTTGCAAATGACATGGGTGAAGGAAGTTAGCTTGGGTAACAGAGTATTATTC CTTGGTGATATCTCATTCTTGATTTCTGCAGATGGGGAAATAAAGGATTTGTCTGATCGT ATCTATTACCATGGATTTAGGAGATCGTACTTCTATCCGATCAAGTCTGGGATTGGCCAA ATCCGCAGCCATTCGTTAATACGCCAGTCCTGCAAACATTACGAGGACCGCAGCCCTCAT ATGCTCAGAGTTTGGATTGAACCACCAACTCTGTTATGA
PEP MSVVTDKRLRRGSPPWSDLPHDILCCIMGHLCYVDQIQFRAVCKNFGLVAGIRPKDKLPW VLTLNFSFKNDMYPSSLYDPCTLEAYKLDHELTSSSWTGVVKLQVCGARNGWLLLAEITP FFFFGHTDFYLYNPFTDDASINLPRLRTKEFKATFTSNLTSPDCLFFAIHADEEREKVMC ISTCSLGDRKWTESLAVEGNLKQVIGVVYIKGIFYCIFKTGMLGSFNPATKKWSLLISEN TNSSELRSLADSFEARFVESDGEVLLVYSKRSYKPWHIFRLDWLQMTWVKEVSLGNRVLF LGDISFLISADGEIKDLSDRIYYHGFRRSYFYPIKSGIGQIRSHSLIRQSCKHYEDRSPH MLRVWIEPPTLL


| Top |