Cherry SNP DataBase

Gene information

Gene Pav_sc0001090.1_g180.1.mk
Chromosome name PAV_r1.0chr8
start 13185671
end 13198002
PAV_r1.0 name Pav_sc0001090.1
start 70615
end 82946
direction +
Annotation NR PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing protein 40A-like
Sequence CDS ATGGCCAATAACCCTCAGTTTTCAGGTCTACAGCCTCTTCGGCCTCCTATGGTTGGTTCT GTTGACCCTCCTCGAAGTTTGCCGCCCATGTCTTTTCAATTCCGGCCAGTAGTTCCAGCA CCACATTCGCAGGAGTTCATTTCTGTGGCTTCTCAAAATTTTCAGCATGTTGGAAGGGGT GTTCCATTGATGAATGTTAGACTGCCTCCTCCAACTCACCAACCCCAGTTTTCGCAACCA ATGCAGCAGTTACCTCCAAGATCTGGTCAGCCAGGTCATGGTATGCTGCCATCACAGGCC ATTCCATTGCCAGTTAGTCAGCCCAACAGAAACTTTGCATCTGAATTGCCCCTACCTCAG CCTAATTCACAAGGTCCAAATAACGCCATGCCCAACTTAGGTGGCCCACGAACACCTCTC TCTTCATCATACACTTTTGCACCTTCTTCTTATGGTCAAATGCCAAGAAGTTTTAATGAC TCCACCCAGTATCAGTCTATATCTCAATTGCATGCACCTAATGTTTCATCGGAGGGACAA GTTACACCTCTGCAGCACACCGGTGAACGGCCTGCTGTAATCACTTCCATTGCTCCGGAA ACAGGTGTACGGCCTAACCCTGCAGGAGGGACCGTGGCAGAATGGAGAGAGCATACATCT GCTGAAGGAAGAAGATTTTATTACAACAGGAGGACAGGATTATCTACTTGGGAGAAGCCT TTTGAATTGATGACACCACTGGAGAGGGCAGATGCATCAACTAACTGGAAGGAATTCACC AGTCCTGATGGAAGAAAGTATTACTACAACAAAGTCACAAAAGAATCAAGATGGATTATG CCTGAGGAACTGAAGTTGGCTCGAGAGCTAGTAGAAAAGGCGCCTGTGAAGGAAATGCAA CAAGAAATGCTTGTAAATCATCATGCCACAGTCACCGTTTCTCCCCCTGTAGCTGAAGCT GATACGCTAGTCAATGATGCCCAAGTAGCATCAAGTCCTGTTTCTGTGGCACCTGTTATT GCCACTGGTGATGGTGATGTTCAAACTGCTGCAGCATCAAGATCATCTACCTCACCTGTT GTGGCTTCTCCTGTAATAGAAAATCCCAATGGAGTTCAGACACCTGTTGTTGTACCATCT TCCGCTGTGTCAAGTGCTGAAGCTGCTGTTACAATCAACGATACTGTTGCAGAACCAATG GAAAGTTCGAACAATTTATCAGCTCAGGATTTTGTTAGTTCTGCTGATGGAGTTCCGTTA CAGGAGAATGAGGAAGCTATGGATGATGTAACAGGAAAGAAAATTAATGATATTGCATCA GAAGAAAAACCAGTTGACCGGGAACCCATAAGTTATGAAAATAAATTGGAGGCTAAAGAT GCATTTAAAGCACTCCTGGAGTCTACCAATATTGGTTCTGATTGGACTTGGGATCGGGCC ATGAGGGTGATAATTAATGACAAAAGATATGGTGCTCTGAAAACACTTGGAGAGCGTAAG CAAGCTTTTAATGAGTTCTTGGTACAAAGGAAAAAACAAGAGGCTGAGGAAAGACGTATC AAACAGAAAAAGGCACGGGAAGAATTCAAAAAAATGTTGGACGAATGCTCAGAGCTAACA TCGTCCACAAGATGGGGAAAAGTAGAGAGCATATTTGAACACGATGAACGCTTCAAAGCT GTTGAACGAGATAGAGATCGCAGGGATATGTTTGAAAACTATGTAGAGGAACTCCAAAAG AAAGCAAGCAGCCAGTGGCGAAAAGTTCAAGATCGTTTAGAGGCTGATGAAAGATGTTCA CGTCTTGAAAAAATTGATCGTTTGGAATTTTTCCAGGAGATAACTCCATCTTCTAAGTGG GAGGACTACAAATCACTTCTTGAAGGTAGTCAAGAGTGCAGTGCTATTGGTGAAGAGAGC TTCTGCAAGGAGATATTTGATAAGCATGTAATGCAACTGAAAGAACAAGCAAAAGAGAAA GAGAGAAAACGAAAGGAGGAAAAGGAAAAGAAGGAAAAGGACAGAGATGATAGAGAAAGG AGACGGACGAAGCAGAGAAGAGAAAAAGAGGTAGAATATGAAAGAGAAAGAGAGGAACGC CTTAAGAAAGATGGTTTAGACAGTGAGATTGCTGATGTAACGGACATTCATGATTCCAAA GAGAAAAAGAGGTCCGGGAAAGATGATAATAAGAAACATAGGAAGCGCCATCATAGTGAT GAAGATCATGCCAATGGAAATGAGAATGATCGGTCTAAAAGATCTCATGGATCTAGCAGT GACCACAAGAAATCAAGACGGGCACCTGGTCATGAATCAGATACCGAAAGCAGACATAGA AGACATAAAAGAGATCACCGGAATGGTTCTCGTAGAAGTGGTGATCACGATGAGCTAGAA GATGGGGAATTTGGCGATGTTGGGGAAAGTCGGTAG
PEP MANNPQFSGLQPLRPPMVGSVDPPRSLPPMSFQFRPVVPAPHSQEFISVASQNFQHVGRG VPLMNVRLPPPTHQPQFSQPMQQLPPRSGQPGHGMLPSQAIPLPVSQPNRNFASELPLPQ PNSQGPNNAMPNLGGPRTPLSSSYTFAPSSYGQMPRSFNDSTQYQSISQLHAPNVSSEGQ VTPLQHTGERPAVITSIAPETGVRPNPAGGTVAEWREHTSAEGRRFYYNRRTGLSTWEKP FELMTPLERADASTNWKEFTSPDGRKYYYNKVTKESRWIMPEELKLARELVEKAPVKEMQ QEMLVNHHATVTVSPPVAEADTLVNDAQVASSPVSVAPVIATGDGDVQTAAASRSSTSPV VASPVIENPNGVQTPVVVPSSAVSSAEAAVTINDTVAEPMESSNNLSAQDFVSSADGVPL QENEEAMDDVTGKKINDIASEEKPVDREPISYENKLEAKDAFKALLESTNIGSDWTWDRA MRVIINDKRYGALKTLGERKQAFNEFLVQRKKQEAEERRIKQKKAREEFKKMLDECSELT SSTRWGKVESIFEHDERFKAVERDRDRRDMFENYVEELQKKASSQWRKVQDRLEADERCS RLEKIDRLEFFQEITPSSKWEDYKSLLEGSQECSAIGEESFCKEIFDKHVMQLKEQAKEK ERKRKEEKEKKEKDRDDRERRRTKQRREKEVEYEREREERLKKDGLDSEIADVTDIHDSK EKKRSGKDDNKKHRKRHHSDEDHANGNENDRSKRSHGSSSDHKKSRRAPGHESDTESRHR RHKRDHRNGSRRSGDHDELEDGEFGDVGESR


| Top |