Cherry SNP DataBase

Gene information

Gene Pav_sc0001102.1_g500.1.mk
Chromosome name PAV_r1.0chr2
start 22487007
end 22487978
PAV_r1.0 name Pav_sc0001102.1
start 231442
end 232413
direction -
Annotation NR PREDICTED: probable disease resistance RPP8-like protein 2
Sequence CDS ATGATCCATTTGAGGTACTTGGGATTGAAGCGTAGCTCCACAACGGAGCTTCCAGAAGAA ATAGGTTGTTTGTCTAACCTGCAGACTCTTGATATTGCAGAAAATTTCAGTCTTTTGAAG ATCCCTGATGTGTTATGGAAGATGAAAAGCCTACGCCACTTTTACATGCATGCACGGCTT CTTGCTGGCAAGTTGCGAATTGACACCCTCCAAAATCTCCAGACTCTATCAGACATGCAT ATTGGTAGTTGGAATGAAACCAGCCCCGCCAATTTAATCAGTCTCCGAAAGTTGGGATTG AAAGGAAGCTTCACTGCAAACAGAGCACCAGGTTCATCTTCATCTTCATCTTTCATCTTT TTGCAGTGGACTTATAAGTCAGATTAA
PEP MIHLRYLGLKRSSTTELPEEIGCLSNLQTLDIAENFSLLKIPDVLWKMKSLRHFYMHARL LAGKLRIDTLQNLQTLSDMHIGSWNETSPANLISLRKLGLKGSFTANRAPGSSSSSSFIF LQWTYKSD


| Top |