Cherry SNP DataBase

Gene information

Gene Pav_sc0001106.1_g470.1.mk
Chromosome name PAV_r1.0chr1
start 40309994
end 40312792
PAV_r1.0 name Pav_sc0001106.1
start 247416
end 250214
direction +
Annotation NR PREDICTED: probable dimethyladenosine transferase
Sequence CDS ATGGCAGGAGGCAAAACAAAGAAAGAGAAGGCGAGGCCAGCAGGGCACACGCCCTACCAA GGAGGCATATCGTTCCACAAGTCCAAAGGACAGCACATCCTCAAGAATCCGTTACTGGTG GACTCCATAGTCCAGAAGTCAGGTATCAAATCCACTGATGTCATTTTAGAGATTGGTCCT GGTACTGGTAATCTCACCAAGAAGCTTCTAGAAGCTGGTAAGAGGGTCATTGCTGTCGAG ATTGACGCTCGAATGGTTCTCGAGCTGCAGAGACGATTTCAGGGCACTCCTCACTCCAAC CGCTTGCAGGTTATTCAAGGAGATGTGCTAAAGACTGAGCTTCCCTATTTTGATATATGT GTGGCAAATATCCCTTATCAAATCTCATCTCCCCTCACATTCAAGTTATTGAAGCACCAA CCTGCTTTCAGATGTGCCATTATAATGTTCCAAAGGGAATTTGCAATGAGACTGGTTGCA CAGCCTGGTGACAAGCTCTACTGTCGTCTTACCGTCAACACGCAACTCTTGTCTCGGGTC TCCCACCTCCTCAAAGTTGGAAGGAACAACTTTCGCCCTCCGCCTAAGGTAGATTCCTCT GTCGTTCGAATTGAACCCAGGAAACCTCCTTTTGAAGTGAACCAAAAGGAGTGGGATGGC TTTTTGCGGATCTGTTTCAATAGGAAGAACAAAACGCTTGGCTCAATTTTTAGGCAGAAA AGTGTCATCAATTTACTAGAGAAGAATTACAAGACCTTGCAGGCGCTTAATCTTGCACCA GGCCAACAAGGTGCCTTGGAGGATACTAATGATGTGATGGATTTTTCAGATGAGGACATA GAGATGGATGATGATGGAGTGGATGATGGAATGGAGGTGGAGGATGGTAATGCAGAAGGG GAGGTATCCGAATTCAAAAAAAAGGTTTTGAGTGTGTTGAAGAAGGGCGGTTTCGAAGGG GAAAGGTCCTCCAAGCTCAAATTACAGCAATTCTTGGACCTACTTTCCGAGTTCAACAAG GATGGTATACACTTCTCCTAA
PEP MAGGKTKKEKARPAGHTPYQGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGP GTGNLTKKLLEAGKRVIAVEIDARMVLELQRRFQGTPHSNRLQVIQGDVLKTELPYFDIC VANIPYQISSPLTFKLLKHQPAFRCAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLLSRV SHLLKVGRNNFRPPPKVDSSVVRIEPRKPPFEVNQKEWDGFLRICFNRKNKTLGSIFRQK SVINLLEKNYKTLQALNLAPGQQGALEDTNDVMDFSDEDIEMDDDGVDDGMEVEDGNAEG EVSEFKKKVLSVLKKGGFEGERSSKLKLQQFLDLLSEFNKDGIHFS


| Top |