Cherry SNP DataBase

Gene information

Gene Pav_sc0001106.1_g540.1.mk
Chromosome name PAV_r1.0chr1
start 40361062
end 40366504
PAV_r1.0 name Pav_sc0001106.1
start 298484
end 303926
direction -
Annotation NR PREDICTED: partner of Y14 and mago
Sequence CDS ATGGCGAGCTGCAACAATGGAGGCGGAGGAGGAGGAGAAGATCAGCCGCCAACGGAAATG GCGGAGCTTAGCAAAACCCTAAAAGACGGAGAGAGAATTCTGGCGCCAACCCGACGACCC GATGGTACGCTTCGCAAACCCATCCGTATTCGGGCTGGGTATGTCCCCCAAGAGGAAGTC GCCATTTACCAATCCAAAGGTGCTTTGTGGAAAAAGGAGATGTCCTCTCAGACTGGACCT CCAGGTTTTGATGATACTTCAGTGGATACAACAAAACCTAAGACTAAGTCTGTAAAGAGG AATGAAAGAAAAAAGGAGAAGCGGATACAGGCTGCTCTTGAAAAGGAGAAAACCTCGGAA AGTGGGGAAACTAAGGAAGAGGAGGCACCTGTTGAAAATCTAGGCCATGTATCAGAATCT GTCAAGTCATTGACATCTCAGATGAACGAGTTAGGCGTTTCTTCTAGTCCTGCTTTAGTT ACACCTCCATCTGACTCAACAGAGGATTCGAATCCAGGGGGACCAGTTCAAGATATTGAT AAAAAAATTCGAGCTCTTAAAAAGAAGATTCGACTTGCCGAAGCTCAACAACAGAAAACT CATCAGCAAGATAATAAGTCAGAGCAGCTGGACAAGTTGACAAAACTGGAAGGTTGGCAT AAGGAGCTAAAGCTTCTGGAGGATAAAAAGAAGGCTGAGTTGACTGCATCGTGA
PEP MASCNNGGGGGGEDQPPTEMAELSKTLKDGERILAPTRRPDGTLRKPIRIRAGYVPQEEV AIYQSKGALWKKEMSSQTGPPGFDDTSVDTTKPKTKSVKRNERKKEKRIQAALEKEKTSE SGETKEEEAPVENLGHVSESVKSLTSQMNELGVSSSPALVTPPSDSTEDSNPGGPVQDID KKIRALKKKIRLAEAQQQKTHQQDNKSEQLDKLTKLEGWHKELKLLEDKKKAELTAS


| Top |