Cherry SNP DataBase

Gene information

Gene Pav_sc0001106.1_g680.1.mk
Chromosome name PAV_r1.0chr1
start 40459316
end 40461884
PAV_r1.0 name Pav_sc0001106.1
start 396738
end 399306
direction -
Annotation NR Auxin-induced protein 5NG4, putative
Sequence CDS ATGCAGAACTATAAAGTGGCAGATGGGATGAAGCCTGTGATGGTAATGGTGCTGGTTCAG ATTTTGTTTGCGGGGATGAATATCTTGTACAAACTAGTGGCTGAAGATGGCATGAATTTT ACGATTCTTATTGCCTACCGTATGATGTTTGCTGCTGCCTTTATGCTTCCCTTGGCTCTC GTATTTGAAAGGGACTGCAGAACAAAACTTACATGGATGGTACTGTTTCAAGCTTTTCTC TGTGGGCTATTTGGGGGTTCACTGTCTCAAAATTTATATATCGAGAGCATAGCTTTAACA TCAGCAACATATGCAGTGGCCATGTATAATCTTGTCCCAGCCATTACTTTTATTCTGGCC ATATTTTTCAGAATGGAGAAGTTGGCCATAGACACTAATGCAGGGAAAGCAAAAGTTGTG GGAACAGTTATGGGGATAGGAGGGGCTATGCTCTTCACCTTCTACAAAGGCATAGAGATT AACATCTGGTCTACACATTTTGATCTTCACAGCCAGCCAAATAGCCATGAGGCATCAATA TCACACAAAAGTTCTGGAAGTCTTTTGTTGGGCTCCATGGTTTCTTTGGGTAGCTGTGTG TCCTATGCTATTTGGTTGATAATTCAGGGAAAACTAAACAAGAGATTCCCTTACCCTTAC TCAAGTACGGCTCTGATGTCCCTGATGGGATCAATTCAATCCGTAGTGTTTGCCCTCTGC GTGGAGAGGGATTGGAACCAGTGGAAGTTGGGCTGGGATATTAGACTTCTTGCAGTTTCT TATTCGCTGAATATTTATACTTTGTATCTGCAAATGTCAGCATACTAG
PEP MQNYKVADGMKPVMVMVLVQILFAGMNILYKLVAEDGMNFTILIAYRMMFAAAFMLPLAL VFERDCRTKLTWMVLFQAFLCGLFGGSLSQNLYIESIALTSATYAVAMYNLVPAITFILA IFFRMEKLAIDTNAGKAKVVGTVMGIGGAMLFTFYKGIEINIWSTHFDLHSQPNSHEASI SHKSSGSLLLGSMVSLGSCVSYAIWLIIQGKLNKRFPYPYSSTALMSLMGSIQSVVFALC VERDWNQWKLGWDIRLLAVSYSLNIYTLYLQMSAY


| Top |