Cherry SNP DataBase

Gene information

Gene Pav_sc0001109.1_g140.1.mk
Chromosome name PAV_r1.0chr2
start 2836052
end 2854565
PAV_r1.0 name Pav_sc0001109.1
start 70423
end 88936
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103330800
Sequence CDS ATGGAAGAGGAGAATGCGGTGGAGCTTTTGCAACGGTATCGTCGGGACAGGCGAATGCTT CTGGATTTTATACTTGCCGGTAGCTTAATAAAGAAGGTGATAATGCCTCCTGGTGCGGTT ACCCTAGATGATGTGGATCTGGACCAAGTCAGTGTTGATTATGTGCTCAATTGTGCTAAG AAAGGTGGTTTATCTGGTGGAATGCTTGAACTCTCGGAAGCTATTAGAGACTACCATGAC CACACTGGGTTACCCCAGATGAATAGTACAGGTTCTGCTGGTGAATTCTTTTTGGTTACG AATCCTGAGTTTTCTGGTTCTCCTCCAAAACGGGCACCACCTGTTCCGGACTTCGTGCCA CTTCCTGTTCTAACTCCACCTCCTGGTGTCTTATCATCTATTCCTGACCTTGACTCTTCT CCGGTTGCATCAAGTGTGTCAAAGTCAGAATCTTTTAACTACACACAAGCTCAAGAACTG ACTGTAGATGATATTGAAGATTTCGAGGATGATGATATTGATGAGGCTGACAGTCTCCGG ATTTCACGAAGGATTCGAAACGATGCTACTGATCTTTCGCTTGGATTGCCTTCTTTTAAG ACAGGTATCACAGAAGATGATCTCCGTGAAACTGCATATGAAGTCCTTTTGGCATGTGCT GGTGCTGCAGGGGGTCTGATTGTGCCGTCAAAAGAGAAAAAGAAAGACAAAAGGTCCAAG CTGATGAGGAAACTTGGACGTAGTAGAAATGAAAATCCTTTGAGTCAGTCTCAACGAGCA CCTGGATTGGTTGGTTTGTTGGAGACCATGCGTGTCCAGATGGAGATATCTGAGGCAATG GACATCAGAACTAGACAAGGGCTGCTTAATGCCCTAGCTGGAAAAGTGGGAAAAAGAATG GATGCCCTACTGGTTCCTCTGGAACTTCTCTGTTGTATTTCACGAACAGAATTTTCTGAC AAGAAGGCGTATATACGGTGGCAGAAAAGGCAGTTGAATATGTTGGAGGAAGGGCTTCTT AATTTCCCTGCTGTCGGATTTGGGGAGTCTGGACGGAAGGCGAGTGAGTTTAGGATTCTT TTAGCAAAAATTGAAGAATCTGAGTTTCTTCCACCTTCCACGGGTGAACTCCAACGAACA GAATGCTTAAGATCTCTTCGAGAGATTGCCACTCCACTTGCTGAGAGGCCTGCTCGTGGT GACTTAACTGGTGAAGTATGTCACTGGGCAGATGGTTATCACTTGAACGTTAGACTGTAT GAGAAACTGCTTCTCAGTGTCTTTGATATGTTAGATGAGGGAAAGTTGACTGAGGAAGTG GAAGAAATACTCGAGCTTGTGAAGTCAACGTGGCGTCATGTTATTACAAGTGAGCATGGA GTTTTAAAACATGCCATTGAACAGTTAAAGAAAATACCATTGAAGGAACAACGGGGACCA CAAGAGAGGTTACACTTGAAGAGTTTGCATTGTAGAGTTGAAGGCGATCAGGGTCACCAA GATTTATCTTTCTTACAGTCCTTCTTGTTGCCCATTCAGAAATGGGCCGATAAGCAGTTA GGAGACTACCATCTGCACTTTTCTGAGGCAATGATGCAATATACATCCAACACAGATCGA GATCAGATAGAATCATATATATCATCTTCTACTAAGAATGCATTTACAAGGATCTTACAG TCTGTTGAAAAATCAGACTCAAAGCATGAACATCCTTTGGCATTGCTTGCTGAAGAGACC AAGAAACTCTTAAAAAAAGATACAACCATGTTCATGCCAATTTTATCCCAGAGGCATCCA CAAGCAACTTCTGTCTCAGCCTCACTCCTTCATAGGCTTTATGGCAACAAGTTGAAACCT TTTCTCGGTGTGGCTGAACATCTGACCGAGGATGTAATATCTGTATTTCCAGCAGCTGAT AACCTTGAGCAGTACATTATGGAACTTATTACGTCCAATTCTGGAGAGGAAACTGCAGAT ATATACTGTAGGAAACTAGCTCCATACCAGATTGGATCCATATCTGGAACATTGGTGATG CGTTGGGTCAATTCGCAACTTGGAAGGGTCTTAGGTTGGGTTGAACGGGCTGTTCAACAA GAGAGGTGGGACCCAATATCACCTCAACAGCGGCATGGGAGTTCAATAGTTGAAGTATTT AGGATTGTGGAGGAGACTGTCGACCAATTTTTTGATCTCAAGGTTCCAATGAGGCCTACA GAATTGAGTGGTTTGTTTCGCGGAGTTGACAATGCTTTTCAAGTGTTCGCAAATCATGTC ATTGACAAGTTGGCTACCAAGGAAGATTTAATTCCACCTGTGCCCATTCTTACAAGATAC AAGAAGGAAGTTGGAATAAAGGCTTTTGTAAAGAAGGAACTATTTGACCCTAGGCTGCCT GATGAGAGAAGGTCTACTGAAATTAGTGTTCGAACGACTCCAACGCTTTGTGTTCAGTTA AATACACTTTATTATGCAATCAGTCAGCTGAATAAGTTGGAAGATAGCATGTGGGAGCGA TGGACGAGGAAGAAGCCCAGCCAAAACTTTACCAAGAAATCCATAGATGAGAAGTCGAAA AGTTTCACCCAAAAGGACACGTTTGATGGGAGTAGAAAAGATATAAATGCTGCTATAGAT CAAATTTGCGAATTCACTGGAACTAAGATTATCTTCTGGGACTTGAGGGAACCATTTATT AACAACTTATATAAACCAAGTGTTTCTCTTTCTAGGTTCGAAGCAGTGTATGAACCACTT GATACGGAACTTAGTCAACTGTGTGCTATAATTGTGGAACCACTAAGGGATCGCATCGTG ACAAGTCTCCTTCAAGCAACGCTGGATGGTTTACTCCGTGTTGTATTAGATGGAGGGCCA TCACGAATTTTCTCTTTGGGCGATGCAAAGCTATTAGAAGAAGATTTGGAGGTCCTCAAG GAGTTTTTTATCTCTGGAGGAGATGGGCTTCCAAGAGGAGTTGTCGAAAATCAGGTAGCA CGTGTTCGAGATGTAATAAAGTTGCACAGCTATGAGACTCGAGAACTGATCGAGGACTTG AAGTCTTCCAGTGGCCTGAACGTGCAGGGTGGTAGAAGCAAACTAGGGGCTGATTCTAAG ACTCTTTTGAGAATCTTATGTCACAGAGCTGATTCGGAGGCCTCTCTTTTCCTTAAGAAG CAGTACAAGATACCAAAGTCCACAGCTTAG
PEP MEEENAVELLQRYRRDRRMLLDFILAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVLNCAK KGGLSGGMLELSEAIRDYHDHTGLPQMNSTGSAGEFFLVTNPEFSGSPPKRAPPVPDFVP LPVLTPPPGVLSSIPDLDSSPVASSVSKSESFNYTQAQELTVDDIEDFEDDDIDEADSLR ISRRIRNDATDLSLGLPSFKTGITEDDLRETAYEVLLACAGAAGGLIVPSKEKKKDKRSK LMRKLGRSRNENPLSQSQRAPGLVGLLETMRVQMEISEAMDIRTRQGLLNALAGKVGKRM DALLVPLELLCCISRTEFSDKKAYIRWQKRQLNMLEEGLLNFPAVGFGESGRKASEFRIL LAKIEESEFLPPSTGELQRTECLRSLREIATPLAERPARGDLTGEVCHWADGYHLNVRLY EKLLLSVFDMLDEGKLTEEVEEILELVKSTWRHVITSEHGVLKHAIEQLKKIPLKEQRGP QERLHLKSLHCRVEGDQGHQDLSFLQSFLLPIQKWADKQLGDYHLHFSEAMMQYTSNTDR DQIESYISSSTKNAFTRILQSVEKSDSKHEHPLALLAEETKKLLKKDTTMFMPILSQRHP QATSVSASLLHRLYGNKLKPFLGVAEHLTEDVISVFPAADNLEQYIMELITSNSGEETAD IYCRKLAPYQIGSISGTLVMRWVNSQLGRVLGWVERAVQQERWDPISPQQRHGSSIVEVF RIVEETVDQFFDLKVPMRPTELSGLFRGVDNAFQVFANHVIDKLATKEDLIPPVPILTRY KKEVGIKAFVKKELFDPRLPDERRSTEISVRTTPTLCVQLNTLYYAISQLNKLEDSMWER WTRKKPSQNFTKKSIDEKSKSFTQKDTFDGSRKDINAAIDQICEFTGTKIIFWDLREPFI NNLYKPSVSLSRFEAVYEPLDTELSQLCAIIVEPLRDRIVTSLLQATLDGLLRVVLDGGP SRIFSLGDAKLLEEDLEVLKEFFISGGDGLPRGVVENQVARVRDVIKLHSYETRELIEDL KSSSGLNVQGGRSKLGADSKTLLRILCHRADSEASLFLKKQYKIPKSTA


| Top |