Cherry SNP DataBase

Gene information

Gene Pav_sc0001110.1_g090.1.mk
Chromosome name PAV_r1.0chr4
start 7091305
end 7095399
PAV_r1.0 name Pav_sc0001110.1
start 50888
end 54982
direction -
Annotation NR PREDICTED: nicotinamide mononucleotide adenylyltransferase
Sequence CDS ATGGACATCCCTCTGCCTCTTAGTAAATTAGCTCTGCATTTGGTTAATCACGACAACAAG GACAAGAAATACGTAGTTCTAGTAGCAACTGGAAGTTTCAATCCTCCTACTTATATGCAT TTACGAATGTTGGAGCTGGCAAGAGATGCACTGAGTTCAGAAGGCTTTTGTGTCATTGGA GGTTATATGTCACCTGTTAATGATGCGTACTATAAGAGGGGCCTTATATCTGCTGAACAT CGTGTACAGTTGTGCCATCTAGCCTGCCAGAGTTCAGAATTTATAATGGTTGATCCTTGG GAGGCAAGACAGAGTAGCTTCCAGCGCACTTTAACTATTCTGTCTAGAGTCAAGGGTTCC TTGTCTGAGGCTGGGCTGATACCCAGTGAATCCCTTAAGTGCATGCTTGTGTGTGGCTCT GATCTACTCCACTCTTTTGGCATTCCTGGAATTTGGATTGCTGAGCAGGTCAGAGGCATA TGCAGAGATTATGGGGTGGTTTGCATTCGCAGGGAAGGACAAGATGTTGATAAAATTATC TCAAATGATGAAATTTTGAAAGAGAACAGGGGTAACATAAGAATCGTGGATGAACTTGTA CCGAACCAAATAAGTTCAACGAGAATAAGGGATTGCATTTCAAGAGGATTGTCAATAAAA TATCTGACTTCTGATGAAGTAATTGATTACATTAGAGAACATCAGCTGTACTTGAACTCA AACGGCATGTGA
PEP MDIPLPLSKLALHLVNHDNKDKKYVVLVATGSFNPPTYMHLRMLELARDALSSEGFCVIG GYMSPVNDAYYKRGLISAEHRVQLCHLACQSSEFIMVDPWEARQSSFQRTLTILSRVKGS LSEAGLIPSESLKCMLVCGSDLLHSFGIPGIWIAEQVRGICRDYGVVCIRREGQDVDKII SNDEILKENRGNIRIVDELVPNQISSTRIRDCISRGLSIKYLTSDEVIDYIREHQLYLNS NGM


| Top |